Recombinant Pseudomonas aeruginosa Glycerol uptake facilitator protein (glpF)

Shipped with Ice Packs
In Stock

Description

Genetic Organization and Structure

The glpF gene in Pseudomonas aeruginosa PAO1 is strategically positioned within a genomic cluster dedicated to glycerol metabolism. This genomic organization reveals sophisticated coordination of glycerol utilization machinery. The glpF gene serves as the promoter-proximal gene of the glpFK operon, indicating its primary position in the transcriptional unit . Within this genomic arrangement, glpF (PA3581) is followed by glpK (glycerol kinase, PA3582), glpR (glycerol regulon repressor, PA3583), and glpD (glycerol 3-phosphate dehydrogenase, PA3584) . This structured arrangement facilitates coordinated regulation of these functionally related genes.

The nucleotide sequence of glpF spans from position 4012806 to 4013645 on the positive strand of the Pseudomonas aeruginosa genome, comprising 839 base pairs . This genetic organization underscores the evolutionary conservation of glycerol metabolism pathways across bacterial species while maintaining species-specific adaptations.

Protein Structure and Membrane Topology

The glpF protein is classified as a multi-pass membrane protein embedded in the inner cell membrane of Pseudomonas aeruginosa . As a member of the major intrinsic protein (MIP) family, glpF likely adopts a characteristic structure with six transmembrane domains forming a channel through which glycerol and selected small molecules can pass.

Studies on the related Escherichia coli GlpF protein have demonstrated that these glycerol facilitators form tetrameric complexes in the membrane. Interestingly, unlike the water-selective aquaporin AqpZ which maintains a stable tetrameric structure, the oligomeric state of GlpF varies depending on environmental conditions: low ionic strength promotes subunit dissociation, while magnesium ions stabilize the tetrameric assembly . Given the high sequence similarity, Pseudomonas aeruginosa glpF likely exhibits similar structural characteristics and oligomeric behavior.

Role in Glycerol Transport

The primary function of the glpF protein in Pseudomonas aeruginosa is to facilitate the transport of glycerol across the cytoplasmic membrane . This transport occurs through facilitated diffusion, an energy-independent process driven by the concentration gradient of glycerol across the membrane . Unlike active transport mechanisms that require ATP hydrolysis, facilitated diffusion through glpF allows for the efficient uptake of glycerol without direct energy expenditure.

The importance of glpF in glycerol transport is evidenced by studies using knockout mutants. Investigations have demonstrated that a ΔglpF mutant of Pseudomonas aeruginosa PAO1 exhibits significantly impaired growth and reduced glycerol utilization capacity . This finding definitively establishes glpF as the primary route for glycerol entry into the bacterial cell.

While predominantly selective for glycerol, the protein also demonstrates limited permeability to water and other small uncharged compounds such as polyols . This selective permeability is critical for maintaining cellular homeostasis while allowing necessary nutrients to enter the cell.

Contribution to Glycerol Metabolism

Following transport into the cell, glycerol is immediately phosphorylated by glycerol kinase (GlpK) to produce glycerol 3-phosphate (G3P), effectively trapping the molecule within the cytoplasm . This phosphorylation step is critical for preventing glycerol from diffusing back out of the cell and initiates the metabolic utilization of glycerol.

The importance of this metabolic pathway is highlighted by research showing that neither ΔglpD nor ΔglpK mutants of Pseudomonas aeruginosa PAO1 can grow in minimal salt medium containing glycerol as the sole carbon source . These findings demonstrate the essential nature of the complete glycerol utilization pathway, beginning with glpF-mediated transport.

G3P, the product of glycerol phosphorylation, serves as a key metabolic intermediate with multiple fates. It can be oxidized by glycerol 3-phosphate dehydrogenase (GlpD) to dihydroxyacetone phosphate, which enters central carbon metabolism . Additionally, G3P serves as a precursor for phospholipid biosynthesis, connecting glycerol metabolism to cell membrane production.

Physiological Significance in P. aeruginosa

The physiological importance of glpF and the glycerol metabolism pathway in Pseudomonas aeruginosa is particularly evident in the context of infection and host adaptation. Research has revealed that Pseudomonas aeruginosa can cleave phosphatidylcholine in the airways of cystic fibrosis patients, yielding phosphorylcholine, fatty acids, and glycerol . This ability to utilize host-derived glycerol provides a significant adaptive advantage during infection.

Studies have demonstrated that Pseudomonas aeruginosa can co-utilize glycerol alongside other carbon sources such as succinate or glucose . This metabolic versatility contributes to the bacterium's remarkable adaptability and persistence in diverse environments, including the human host.

Interestingly, the regulation of glpF expression involves a sophisticated system centered around the GlpR repressor protein. Rather than responding directly to glycerol, this regulatory system uses G3P as the effector molecule to induce expression of glpFK and glpD . This regulatory mechanism ensures appropriate coordination of glycerol transport and metabolism in response to environmental conditions.

Expression Systems for Recombinant glpF

Several expression systems have been developed for the production of recombinant Pseudomonas aeruginosa glpF protein. One common approach involves expressing the protein in Escherichia coli, which provides a well-established and efficient heterologous expression system . The recombinant protein is typically produced with affinity tags, such as a histidine tag (His-tag), to facilitate purification.

Commercial sources offer recombinant full-length Pseudomonas aeruginosa glpF protein (amino acids 1-279) fused to an N-terminal His-tag, expressed in Escherichia coli . The availability of these commercial preparations has facilitated research on this important membrane protein.

Additionally, innovative expression systems have been developed using glpF as a fusion partner for other membrane proteins. One such system utilizes the highly expressed Escherichia coli GlpF as a fusion partner for eukaryotic membrane proteins, demonstrating the utility of glycerol facilitators in heterologous membrane protein expression .

Purification Techniques

The purification of recombinant glpF typically employs immobilized metal affinity chromatography (IMAC), leveraging the interaction between histidine tags and metal ions such as nickel . This approach allows for selective retention of the His-tagged protein while contaminants are washed away.

The purification process must be conducted under conditions that maintain the native structure of the membrane protein. This usually involves the use of detergents such as octyl glucoside to solubilize the membrane protein while preserving its structural integrity . The choice of detergent and buffer conditions significantly impacts the oligomeric state and stability of the purified protein.

Purified recombinant glpF can be obtained with greater than 90% purity as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) . The purified protein is typically stored in a buffer containing a stabilizing agent such as trehalose to maintain its structural integrity during storage.

Table 1: Typical Properties of Recombinant Pseudomonas aeruginosa glpF Protein

PropertyDescription
Length279 amino acids (full length)
Molecular Weight~25 kDa
Expression SystemEscherichia coli
Affinity TagN-terminal His-tag
Purification MethodImmobilized metal affinity chromatography
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Purity>90% by SDS-PAGE
ReconstitutionIn deionized water to 0.1-1.0 mg/mL with 5-50% glycerol

Comparison with Escherichia coli GlpF

The Pseudomonas aeruginosa glpF protein shares significant homology with its counterpart in Escherichia coli, with 70% amino acid sequence identity . This substantial similarity suggests conservation of fundamental structural and functional properties between these proteins.

Studies on Escherichia coli GlpF have provided valuable insights that may be applicable to understanding Pseudomonas aeruginosa glpF. The Escherichia coli protein has been shown to form tetrameric complexes in the membrane, though its oligomeric state can vary depending on buffer conditions . Unlike the water-selective aquaporin AqpZ, which maintains a stable tetrameric structure, GlpF exhibits greater structural flexibility.

Functional studies have demonstrated that Escherichia coli GlpF is highly permeable to glycerol but less well permeated by water . Both glycerol and water permeability occur with low Arrhenius activation energies and are reversibly inhibited by mercury chloride . These characteristics likely apply to Pseudomonas aeruginosa glpF as well, given the high sequence conservation.

Evolutionary Relationships Among Bacterial Glycerol Facilitators

The glycerol facilitator represents one of the few known examples of bacterial solute transport proteins that catalyze facilitated diffusion across the cytoplasmic membrane . This distinctive transport mechanism sets it apart from the more common active transport systems found in bacteria.

Sequence comparisons have revealed significant conservation of glycerol facilitators across diverse bacterial species, including Pseudomonas aeruginosa, Escherichia coli, and Haemophilus influenzae . This conservation reflects the fundamental importance of glycerol as a carbon and energy source throughout bacterial evolution.

Despite this conservation, species-specific adaptations in glycerol facilitator structure and function likely exist. These adaptations may reflect differences in cellular physiology, metabolic requirements, or environmental niches occupied by different bacterial species. The 30% sequence divergence between Pseudomonas aeruginosa and Escherichia coli glycerol facilitators provides potential for functional specialization while maintaining the core transport capability.

Transport Properties

The transport properties of recombinant glpF can be assessed through various experimental approaches, particularly using reconstituted proteoliposome systems. Based on studies of the related Escherichia coli GlpF, the glycerol facilitator typically demonstrates high permeability to glycerol, with increases in glycerol permeability exceeding 100-fold when reconstituted into proteoliposomes compared to control liposomes .

The kinetics of glycerol transport through glpF are characterized by facilitated diffusion down a concentration gradient. This process occurs with a low Arrhenius activation energy, indicating minimal energy barriers to transport . This efficiency in transport is crucial for the rapid uptake of glycerol when it becomes available in the environment.

Water permeability through glpF, while present, is typically lower than that observed for dedicated water channels like aquaporins. Studies with Escherichia coli GlpF have shown increases in water permeability up to 10-fold when reconstituted into proteoliposomes . This dual permeability to both glycerol and water reflects the protein's evolutionary adaptation to facilitate nutrient uptake while maintaining some degree of water permeability.

Substrate Specificity

The glycerol facilitator demonstrates selective permeability, predominantly facilitating the passage of glycerol while also permitting limited transport of water and other small uncharged compounds such as polyols . This substrate specificity is determined by the structural features of the channel, particularly the dimensions and chemical properties of the pore.

Research on the substrate specificity of glycerol facilitators has enhanced our understanding of the molecular determinants of selective transport across biological membranes. The channel's architecture is precisely tailored to accommodate glycerol molecules while excluding larger solutes and charged particles.

In the context of Pseudomonas aeruginosa physiology, this selective permeability ensures efficient uptake of glycerol from the environment while maintaining the integrity of the cellular contents and the proton motive force across the membrane.

Inhibition Studies

Inhibition studies provide valuable insights into the functional mechanisms of membrane transport proteins. Research on Escherichia coli GlpF has demonstrated that both glycerol and water permeability through the channel are reversibly inhibited by mercury chloride . This inhibition likely results from the interaction of mercury with cysteine residues in the protein, affecting channel conformation or directly blocking the pore.

Understanding the inhibition profile of glpF has practical implications for the development of potential inhibitors that could target glycerol metabolism in Pseudomonas aeruginosa. Given the importance of glycerol utilization for this bacterium, particularly in the context of infection, such inhibitors could have therapeutic potential.

The development of specific inhibitors for glpF would require detailed knowledge of the protein's structure and the molecular mechanisms of transport. Recombinant expression and purification systems provide valuable tools for such investigations, allowing for detailed biochemical and structural studies.

Use in Membrane Protein Studies

Recombinant Pseudomonas aeruginosa glpF has significant value as a model system for studying membrane protein structure, function, and dynamics. As a relatively small and functionally well-defined membrane protein, glpF provides an excellent platform for investigating the fundamental principles of membrane transport.

The glycerol facilitator has also been utilized as a fusion partner for the expression of eukaryotic membrane proteins in bacterial systems. A fusion protein expression system has been developed that allows for the production of eukaryotic integral membrane proteins in Escherichia coli by fusing them to the C-terminus of the highly expressed glycerol-conducting channel protein . This application demonstrates the utility of glpF in biotechnological applications beyond its native function.

Studies of glpF and related transport proteins contribute to our broader understanding of membrane biology, including principles of selective permeability, the structural basis of substrate specificity, and the dynamics of membrane protein complexes.

Applications in Biotechnology

The glycerol facilitator has potential applications in various biotechnological contexts. Its ability to efficiently transport glycerol across membranes could be harnessed in bioprocessing applications where glycerol utilization or production is desired.

The development of expression and purification systems for recombinant glpF has established methodologies that can be applied to other membrane proteins of interest. These technical advances contribute to the broader field of membrane protein biochemistry and structural biology.

Additionally, the glycerol facilitator system in Pseudomonas aeruginosa could serve as a target for metabolic engineering approaches aimed at enhancing glycerol utilization or altering carbon flux through central metabolic pathways.

Potential Therapeutic Targets

The importance of glycerol metabolism for Pseudomonas aeruginosa adaptation and survival in host environments, particularly in cystic fibrosis patients, suggests that the glycerol facilitator could represent a potential therapeutic target . Inhibition of glycerol transport could potentially attenuate bacterial growth and virulence in these contexts.

Research has demonstrated that Pseudomonas aeruginosa can cleave phosphatidylcholine in cystic fibrosis airways to yield glycerol, which serves as a carbon source . Disrupting this nutritional adaptation by targeting glpF could potentially reduce bacterial persistence in the lung environment.

The development of specific inhibitors for glpF would require detailed structural and functional characterization of the protein. Recombinant expression systems provide valuable tools for such investigations, facilitating the screening of potential inhibitory compounds and the elucidation of their mechanisms of action.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
glpF; PA3581; Glycerol uptake facilitator protein; Glycerol diffusion facilitator
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-279
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
glpF
Target Protein Sequence
MTTAAPTPSLFGQCLAEFLGTALLIFFGTGCVAALKVAGASFGLWEISIIWGVGVSMAIYLSAGVSGAHLNPAVSIALWLFAGFEGRKLPFYITAQVAGAFCAAALVYTLYSSLFIEFEQAQNIVRGSQDSLALASVFSTYPHPALSVGQAFLVEVVITAILMAVIMALTDDGNGLPRGPLAPLLIGLLIAVIGSAMGPLTGFAMNPARDFGPKLMTYLAGWGPIAFTGGREIPYFLVPIFAPILGACLGAGGYRVLIARHLPSAAAPAEAEPEKVRAS
Uniprot No.

Target Background

Function
Glycerol enters the cell via the glycerol diffusion facilitator protein. This membrane protein facilitates the movement of glycerol across the cytoplasmic membrane.
Database Links

KEGG: pae:PA3581

STRING: 208964.PA3581

Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the glycerol uptake facilitator protein (glpF) in Pseudomonas aeruginosa?

The glycerol facilitator protein (glpF) in Pseudomonas aeruginosa is a bacterial solute transport protein that catalyzes facilitated diffusion of glycerol across the cytoplasmic membrane . It functions as part of a transport system that, together with glycerol kinase (glpK), mediates the entry of external glycerol into cellular metabolism . The glycerol kinase traps glycerol in the cytoplasm by phosphorylating it to form sn-glycerol 3-phosphate . This system represents one of the few known examples of bacterial facilitated diffusion transport mechanisms, as opposed to the more common active transport systems.

What is the molecular mass and structure of P. aeruginosa glpF?

The glycerol facilitator protein (glpF) from Pseudomonas aeruginosa has an apparent molecular mass of approximately 25 kDa, while its partner protein glycerol kinase (glpK) has an apparent molecular mass of 56 kDa . These proteins were identified using a T7 expression system. The amino acid sequence of P. aeruginosa glpF shares 70% identity with its counterpart in Escherichia coli, indicating significant conservation of this protein across bacterial species . Similarly, the glycerol kinase shows 81% identity with its E. coli counterpart, with this similarity extending to homologues in the genome of Haemophilus influenzae .

How is the glpF gene organized in the P. aeruginosa genome?

In Pseudomonas aeruginosa, the glpF gene is organized as part of the glpFK operon, where glpF is positioned as the promoter-proximal gene . This operon was isolated on a 4.5 kb EcoRI fragment from a chromosomal mini-library through functional complementation of an Escherichia coli glpK mutant . The chromosomal mapping of the glpFK region was established with the assistance of a PCR-amplified glpK segment . Additionally, upstream of the glpFK operon, researchers have identified two open reading frames, orfX and orfY, which encode a putative regulatory protein and a carbohydrate kinase of unknown function, respectively .

What methods are effective for isolating and expressing recombinant P. aeruginosa glpF?

For the isolation and expression of recombinant P. aeruginosa glpF, researchers have successfully employed the following methodology:

  • Gene Isolation: The glpF gene can be isolated on a 4.5 kb EcoRI fragment from a chromosomal mini-library of P. aeruginosa .

  • Functional Complementation: Utilizing functional complementation of an E. coli glpK mutant after establishing a map of the chromosomal glpFK region with PCR-amplified segments .

  • Expression System: The T7 expression system has proven effective for producing and identifying the glycerol facilitator protein with its apparent molecular mass of 25 kDa .

  • Cloning Strategy: For complementation studies, the wild type glpF gene can be amplified by PCR using primers that capture regions approximately 134 bp upstream and 99 bp downstream of the gene, incorporating appropriate restriction sites (e.g., BamHI and PstI) . The PCR products can then be digested and cloned into an appropriate plasmid vector, such as pT181 .

  • Transformation Protocol: The recombinant plasmid can be introduced into recipient strains through electroporation, with selection for appropriate antibiotic resistance markers included in the vector .

How can researchers effectively design experiments to study glpF function in P. aeruginosa?

When designing experiments to study glpF function in P. aeruginosa, researchers should consider the following systematic approach:

  • Clear Research Question Formulation: Begin by formulating a clear, concise, and open-ended research question that focuses on specific aspects of glpF function. For example, rather than broadly asking "How does glpF affect P. aeruginosa?", specify "How does glpF expression influence glycerol metabolism under anaerobic conditions in P. aeruginosa?" .

  • Genetic Manipulation Strategies:

    • Generate knockout mutants: Create ΔglpF mutants by gene replacement techniques to assess phenotypic changes .

    • Complementation studies: Reintroduce the wild-type glpF gene using appropriate vectors to confirm that observed phenotypes are specifically due to glpF disruption .

    • Overexpression experiments: Utilize inducible promoter systems to study the effects of increased glpF expression.

  • Functional Assays:

    • Transport studies to measure glycerol uptake rates under various conditions.

    • Growth analyses in media with glycerol as the sole carbon source.

    • Metabolic profiling to assess changes in glycerol metabolism pathways.

  • Expression Analysis:

    • Real-time RT-PCR to quantify glpF expression levels under different conditions .

    • Western blotting to monitor protein production.

    • Reporter gene fusion constructs to visualize expression patterns.

  • Parameter Estimation and Model Discrimination: Implement mathematical modeling approaches to integrate experimental data and predict system behavior under untested conditions .

  • Randomization, Replication, and Blocking: Ensure robust experimental design by incorporating these classical principles to minimize bias and account for variance .

What gene expression analysis techniques are most suitable for studying glpF regulation?

For studying glpF regulation in P. aeruginosa, several gene expression analysis techniques have proven particularly effective:

  • Real-time Reverse Transcription PCR (RT-PCR): This technique has been successfully employed to assess transcription levels of glpF under different growth conditions. For example, studies have shown that glpF expression is significantly upregulated (144-fold higher) in L-form bacteria compared to classical form bacteria . The protocol involves:

    • RNA isolation from bacterial cultures grown under specific conditions

    • cDNA synthesis using reverse transcriptase

    • Quantitative PCR with SYBR Green or similar fluorescent dyes

    • Normalization against housekeeping genes (e.g., 16S rRNA)

    • Analysis using the comparative threshold cycle (ΔΔCt) method

  • Promoter-Reporter Fusions: Constructing fusions between the glpF promoter region and reporter genes (e.g., lacZ, gfp) to monitor promoter activity under various conditions.

  • Transcriptome Analysis: RNA-seq or microarray studies to examine global gene expression patterns, including glpF, under various physiological conditions or genetic backgrounds.

  • Chromatin Immunoprecipitation (ChIP): To identify transcription factors and other regulatory proteins that bind to the glpF promoter region.

  • In vitro Transcription Assays: To study the direct effects of purified regulatory proteins on glpF transcription.

How does glpF contribute to bacterial persistence and L-form formation in P. aeruginosa?

The glycerol uptake facilitator protein (glpF) plays a critical role in bacterial persistence and L-form formation in P. aeruginosa. L-forms are cell wall-deficient bacterial variants that can develop under certain stress conditions, including antibiotic exposure. Research has revealed several key aspects of glpF's contribution to these phenomena:

What are the implications of comparing glpF sequences and functions across different bacterial species?

Comparative analysis of glpF sequences and functions across different bacterial species provides valuable insights into evolutionary relationships, functional conservation, and species-specific adaptations:

  • Sequence Conservation: The P. aeruginosa glycerol facilitator shows 70% amino acid sequence identity with its E. coli counterpart, while the glycerol kinase (glpK) exhibits even higher conservation at 81% identity . This similarity extends to homologues in other bacterial species such as Haemophilus influenzae . Such high conservation suggests strong evolutionary pressure to maintain the structure and function of these proteins.

  • Functional Complementation Capabilities: The ability of P. aeruginosa glpF to complement E. coli glpK mutants demonstrates functional conservation across species boundaries . This cross-species functionality suggests that despite any sequence differences, the core mechanistic features of glycerol transport are preserved.

  • Species-Specific Adaptations: Despite high sequence similarity, species-specific differences in glycerol metabolism regulation may exist, reflecting adaptations to different ecological niches and metabolic requirements. These variations may involve:

    • Regulatory mechanisms controlling glpF expression

    • Interaction partners within membrane transport complexes

    • Substrate specificity or transport kinetics

    • Integration with broader metabolic networks

  • Evolutionary Implications: Phylogenetic analysis of glpF sequences can provide insights into the evolutionary history of glycerol transport mechanisms across bacterial lineages, potentially revealing horizontal gene transfer events or convergent evolution.

How can researchers address challenges in purifying functional recombinant glpF protein?

Purifying functional recombinant membrane proteins like glpF presents several challenges. Here are methodological strategies to address these difficulties:

  • Optimized Expression Systems:

    • Bacterial Expression: Use specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3)) with tunable promoters to prevent toxicity from overexpression.

    • Cell-Free Systems: Consider cell-free protein synthesis for difficult-to-express membrane proteins, which allows direct incorporation into artificial membranes or nanodiscs.

    • Expression Temperature: Lower induction temperatures (16-20°C) to slow protein production and improve folding.

  • Fusion Tag Selection:

    • Employ N- or C-terminal tags that enhance solubility (e.g., MBP, SUMO) while ensuring they don't interfere with channel function.

    • Consider using GFP fusions to monitor expression, folding, and membrane integration in real-time.

  • Detergent Screening:

    • Systematic screening of detergents is crucial for extracting functional glpF from membranes.

    • Begin with mild detergents like DDM, LMNG, or digitonin that often preserve protein structure.

    • Consider fluorescence-based thermal stability assays to identify optimal detergent conditions.

  • Alternative Membrane Mimetics:

    • Nanodiscs or styrene-maleic acid lipid particles (SMALPs) can extract membrane proteins with their native lipid environment.

    • Amphipols can stabilize membrane proteins in detergent-free solutions after initial extraction.

  • Functional Validation Methods:

    • Develop liposome reconstitution assays to verify glycerol transport activity of purified glpF.

    • Implement label-free methods like isothermal titration calorimetry or surface plasmon resonance to assess substrate binding.

    • Consider structural studies (X-ray crystallography, cryo-EM, or NMR) to confirm proper folding.

What are common pitfalls in glpF mutant complementation studies and how can they be avoided?

Complementation studies are critical for confirming the specificity of mutant phenotypes, but researchers often encounter several challenges when working with glpF. Here are common pitfalls and strategies to address them:

  • Expression Level Discrepancies:

    • Pitfall: Inappropriate expression levels (too high or too low) compared to native conditions.

    • Solution: Use native promoters when possible, or employ inducible systems with careful titration of inducer concentrations. For example, researchers found that successful complementation of glpF mutants required induction with tetracycline in liquid culture prior to plating .

  • Timing of Expression:

    • Pitfall: Incorrect timing of complementing gene expression relative to phenotype development.

    • Solution: Implement time-course experiments with controlled induction at different growth phases. Studies have shown that inducible expression is critical for successful complementation of L-form defects .

  • Vector Selection Issues:

    • Pitfall: Unsuitable vector backbone causing plasmid instability or incompatibility.

    • Solution: Select vectors with appropriate copy number and compatibility with the host strain. Vectors like pT181 have been successfully used for glpF complementation in S. aureus studies .

  • Cloning Design Problems:

    • Pitfall: Omitting regulatory regions or introducing mutations during cloning.

    • Solution: Include adequate upstream regions (e.g., 134 bp upstream of glpF) to capture native regulatory elements . Verify constructs by sequencing before complementation experiments.

  • Strain Background Effects:

    • Pitfall: Secondary mutations or strain-specific factors affecting complementation.

    • Solution: Include appropriate controls and consider complementation in multiple strain backgrounds to ensure reproducibility.

How can researchers interpret contradictory results in glpF functional studies?

When faced with contradictory results in glpF functional studies, researchers should implement a systematic approach to resolve these discrepancies:

  • Methodological Variations Assessment:

    • Examine differences in experimental conditions (media composition, temperature, oxygen availability)

    • Compare genetic backgrounds of bacterial strains used (wild-type source, presence of secondary mutations)

    • Analyze protein expression levels and localization in different studies

  • Statistical Robustness Evaluation:

    • Assess sample sizes and statistical methods employed

    • Implement more robust statistical analyses with appropriate controls

    • Consider meta-analysis approaches when multiple studies are available

  • Genetic Context Consideration:

    • Investigate potential polar effects on adjacent genes in the glpFK operon

    • Examine differences in complementation strategies (chromosomal vs. plasmid-based)

    • Consider the influence of regulatory elements (orfX, orfY) upstream of the glpFK operon

  • Growth Condition-Dependent Effects:

    • Test functionality under various stress conditions, as some phenotypes may only manifest under specific circumstances

    • Compare results from classical form bacteria versus L-form bacteria, which show dramatic differences in glpF expression (144-fold higher in L-forms)

  • Alternative Hypothesis Development:

    • Formulate new hypotheses that could explain seemingly contradictory results

    • Design critical experiments specifically to distinguish between competing explanations

    • Consider that glpF may have multiple functions or context-dependent roles

What experimental controls are essential when studying recombinant P. aeruginosa glpF?

When studying recombinant P. aeruginosa glpF, implementing rigorous controls is critical for generating reliable and interpretable data. Essential experimental controls include:

  • Genetic Controls:

    • Negative Control: Empty vector transformants to account for vector-related effects.

    • Positive Control: Wild-type strain expressing native glpF.

    • Complementation Control: Mutant strain complemented with wild-type glpF to verify phenotype restoration .

    • Domain Mutation Controls: Site-directed mutants affecting key functional domains to verify structure-function relationships.

  • Expression Controls:

    • Expression Level Verification: Western blot or RT-PCR analysis to confirm appropriate expression levels of recombinant glpF .

    • Localization Control: Membrane fraction analysis to confirm proper targeting of the recombinant protein.

    • Induction Controls: For inducible systems, uninduced samples and dose-response measurements to characterize expression dynamics.

  • Functional Assays Controls:

    • Substrate Specificity Controls: Testing transport of related molecules to confirm specificity for glycerol.

    • Transport Inhibition Controls: Using known channel blockers to verify that observed effects are channel-dependent.

    • Growth Condition Controls: Testing phenotypes under multiple conditions, as seen in the differential expression between normal and L-form bacteria .

  • Technical Controls:

    • Normalization Controls: Housekeeping genes (e.g., 16S rRNA) for RT-PCR experiments .

    • Sample Processing Controls: Monitoring for RNA degradation or protein denaturation during preparation.

    • Cross-Contamination Controls: Regular verification of strain purity and plasmid stability.

How should researchers quantify and compare glpF expression levels across different conditions?

Accurate quantification and comparison of glpF expression levels across different conditions requires a methodical approach incorporating multiple techniques and appropriate statistical analysis:

  • Real-Time RT-PCR Protocol:

    • Collect bacterial samples from precisely defined conditions (e.g., L-form vs. classical form bacteria)

    • Extract high-quality RNA using standardized protocols with RNase inhibitors

    • Perform reverse transcription with consistent cDNA synthesis conditions

    • Use carefully designed primers specific to glpF (verify specificity with melting curve analysis)

    • Include technical replicates (minimum triplicate) and biological replicates (minimum triplicate)

    • Normalize expression against multiple reference genes (not just one) that are stable under your experimental conditions

    • Calculate relative expression using the comparative Ct (ΔΔCt) method with appropriate error propagation

  • Absolute Quantification Approaches:

    • Develop standard curves using known quantities of glpF template

    • Calculate absolute copy numbers for more precise comparisons across independent experiments

    • Consider digital PCR for higher precision when detecting small differences in expression

  • Complementary Methods for Validation:

    • Northern blotting to verify transcript size and integrity

    • RNA-seq for genome-wide expression context and alternative transcript detection

    • Western blotting or proteomics to confirm translation of detected transcripts

    • GFP-reporter fusions to visualize expression patterns at the single-cell level

  • Statistical Analysis Framework:

    • Apply appropriate statistical tests based on data distribution (parametric vs. non-parametric)

    • Use ANOVA with post-hoc tests for multiple condition comparisons

    • Implement mixed-effects models when incorporating multiple variables

    • Report effect sizes along with p-values to indicate biological significance

    • Consider power analysis to ensure adequate sample sizes for detecting biologically relevant differences

What bioinformatic approaches can help identify potential regulatory elements affecting glpF expression?

Various bioinformatic approaches can help identify potential regulatory elements affecting glpF expression:

  • Promoter Analysis:

    • Apply prokaryotic promoter prediction algorithms to identify -10 and -35 elements

    • Search for transcription factor binding site (TFBS) motifs using position weight matrices

    • Perform comparative genomics across Pseudomonas species to identify conserved non-coding regions

    • Analyze DNA curvature and thermal stability profiles for potential regulator interaction sites

  • Operon Structure Prediction:

    • Use operon prediction tools to confirm the organization of the glpFK operon

    • Analyze intergenic regions for terminators, attenuators, and other regulatory features

    • Identify potential alternative promoters within the operon

  • Regulatory Network Analysis:

    • Implement co-expression network analyses using existing transcriptomic datasets

    • Perform regulatory motif enrichment analysis across co-regulated genes

    • Apply Bayesian network modeling to predict regulatory relationships

    • Analyze the potential influence of the upstream orfX (putative regulatory protein) on glpF expression

  • Small RNA Prediction:

    • Screen for potential small RNA binding sites in the glpF mRNA

    • Identify RNA thermosensors or riboswitches that might regulate translation

    • Analyze RNA secondary structure around the translation initiation region

  • Epigenetic Feature Prediction:

    • Predict DNA methylation patterns that might influence transcription factor binding

    • Analyze DNA structural properties that might affect DNA-protein interactions

How can researchers differentiate between direct and indirect effects of glpF mutations in phenotypic studies?

Differentiating between direct and indirect effects of glpF mutations requires a multi-faceted experimental approach:

  • Complementation Analysis Framework:

    • Full Complementation: Restoration of wild-type phenotype with the native glpF gene confirms direct causality

    • Partial Complementation: May indicate secondary mutations or polar effects on adjacent genes

    • Domain-Specific Complementation: Using variants with specific functional domains altered helps define mechanism

  • Polar Effect Assessment:

    • Analyze expression of downstream genes (e.g., glpK) in the glpF mutant

    • Create non-polar mutations that preserve downstream gene expression

    • Complement with the entire glpFK operon versus individual genes

  • Temporal Resolution Studies:

    • Implement time-course experiments to establish cause-effect relationships

    • Use inducible expression systems to control timing of complementation

    • Monitor primary metabolic changes that occur immediately after glpF induction/repression

  • Metabolomic Profiling:

    • Compare metabolite profiles between wild-type, mutant, and complemented strains

    • Focus on glycerol-related metabolic pathways to identify direct biochemical consequences

    • Use isotope labeling to track metabolic flux changes directly attributable to glpF function

  • Genetic Interaction Analysis:

    • Create double mutants combining glpF mutations with related pathway components

    • Perform suppressor screens to identify genes that can compensate for glpF deficiency

    • Implement synthetic genetic array analysis to map the genetic interaction network

How does P. aeruginosa glpF compare structurally and functionally to glycerol facilitators in other bacterial species?

The glycerol facilitator protein (glpF) in Pseudomonas aeruginosa shows significant structural and functional similarities to its counterparts in other bacterial species, while also exhibiting some distinct characteristics:

Table 1: Comparative Analysis of Bacterial Glycerol Facilitators

SpeciesMolecular MassSequence Identity to P. aeruginosa glpFKey Functional Features
Pseudomonas aeruginosa25 kDa100%Facilitates glycerol diffusion across cytoplasmic membrane; works with glpK to metabolize glycerol
Escherichia coli~28 kDa70%Well-characterized member of aquaporin family; highly selective for linear polyols
Haemophilus influenzaeNot specifiedSimilar to E. coli homologueGenome contains homologues with significant similarity to P. aeruginosa glpF
Staphylococcus aureusNot specifiedNot specifiedEssential for L-form formation and antibiotic persistence; dramatically upregulated (144-fold) in L-forms

Structural Conservation:

  • The 70% amino acid sequence identity between P. aeruginosa and E. coli glpF proteins indicates highly conserved structural elements essential for glycerol transport function .

  • This conservation likely extends to the characteristic aquaporin fold with six transmembrane segments and the signature NPA (Asparagine-Proline-Alanine) motifs that form the selective pore.

Functional Comparison:

  • Like its E. coli counterpart, P. aeruginosa glpF catalyzes facilitated diffusion of glycerol across the cytoplasmic membrane without energy expenditure .

  • In both organisms, glpF works in concert with glycerol kinase (glpK) to trap transported glycerol as sn-glycerol 3-phosphate in the cytoplasm .

  • The functional conservation is evidenced by successful complementation experiments, where P. aeruginosa glpF genes could restore function in E. coli glpK mutants .

Evolutionary Implications:
The high degree of sequence and functional conservation across diverse bacterial species suggests that the glycerol facilitator represents an ancient and fundamental transport system that emerged early in bacterial evolution. The selective pressure to maintain this functionality likely reflects the importance of glycerol as a carbon and energy source in various ecological niches.

What insights can structural modeling provide about the glycerol transport mechanism of P. aeruginosa glpF?

Structural modeling of P. aeruginosa glpF can provide valuable insights into its glycerol transport mechanism, building upon the substantial knowledge of aquaporin family proteins:

  • Channel Architecture Prediction:

    • Homology modeling based on the 70% sequence identity with E. coli glpF can reveal the likely arrangement of the six transmembrane α-helices and the loop regions that form the characteristic hourglass structure.

    • The NPA (Asparagine-Proline-Alanine) motifs likely form the selective filter region that determines substrate specificity for glycerol over water or other molecules.

    • Aromatic/arginine (ar/R) constriction region modeling can explain the selectivity differences between water-specific aquaporins and glycerol-conducting aquaglyceroporins.

  • Substrate Coordination Mechanism:

    • Molecular dynamics simulations can identify key residues that coordinate glycerol molecules during passage through the channel.

    • Energy landscape calculations can reveal the energetic barriers and favorable interaction sites along the transport pathway.

    • Quantum mechanical calculations can provide insights into hydrogen bonding networks that facilitate glycerol passage while excluding protons.

  • Oligomerization Interfaces:

    • P. aeruginosa glpF likely forms tetramers like other aquaporins, with structural modeling revealing the residues involved in monomer-monomer interactions.

    • The tetrameric assembly may influence channel gating or regulation through cooperative effects.

  • Species-Specific Adaptations:

    • Comparative modeling between P. aeruginosa and E. coli glpF can highlight the 30% sequence differences and their potential functional implications.

    • These differences may reflect adaptations to the specific membrane composition or metabolic requirements of Pseudomonas.

  • Rational Mutagenesis Targets:

    • Structural models can identify critical residues predicted to affect channel conductance, substrate specificity, or regulation.

    • These predictions can guide site-directed mutagenesis experiments to verify structure-function relationships.

How has the glpF gene evolved in Pseudomonas species and what does this reveal about selective pressures?

The evolutionary history of the glpF gene in Pseudomonas species provides insights into selective pressures and adaptive strategies across this diverse bacterial genus:

  • Sequence Conservation Patterns:

    • Core functional domains show high conservation across Pseudomonas species, particularly the NPA motifs and pore-lining residues essential for glycerol transport.

    • The 70% sequence identity with E. coli counterparts suggests ancient divergence but continued functional conservation .

    • Variable regions may correlate with species-specific adaptations to different ecological niches or metabolic contexts.

  • Operon Structure Evolution:

    • The organization of glpF as the promoter-proximal gene in the glpFK operon appears conserved in P. aeruginosa , but comparative genomics across Pseudomonas species might reveal variations in this arrangement.

    • The presence of upstream regulatory elements (orfX and orfY) may vary across species, reflecting different regulatory strategies.

  • Horizontal Gene Transfer Assessment:

    • Phylogenetic analysis of glpF sequences can identify potential horizontal gene transfer events within or between bacterial genera.

    • Anomalous GC content or codon usage bias in certain species' glpF genes would suggest recent acquisition through horizontal transfer.

  • Selection Pressure Analysis:

    • Calculating dN/dS ratios (non-synonymous to synonymous substitution rates) can reveal whether glpF has undergone purifying selection (conserving function) or positive selection (adapting new functions).

    • Site-specific selection analysis can identify specific amino acid positions under unusual selective pressure.

  • Ecological Correlation:

    • Comparing glpF sequence variations with the ecological niches of different Pseudomonas species can reveal environment-specific adaptations.

    • Species adapted to glycerol-rich environments may show evidence of selection for enhanced transport efficiency or regulatory flexibility.

What emerging technologies could advance our understanding of glpF function and regulation?

Several cutting-edge technologies offer promising approaches to deepen our understanding of glpF function and regulation:

  • CRISPR-Cas Based Approaches:

    • CRISPR interference (CRISPRi) for tunable repression of glpF to study dosage effects without complete knockout

    • Base editing for introducing specific point mutations without double-strand breaks

    • CRISPR screening to identify genetic interactions with glpF across the genome

  • Advanced Imaging Techniques:

    • Single-molecule fluorescence microscopy to track glpF localization and dynamics in living cells

    • Super-resolution microscopy (PALM/STORM) to visualize nanoscale distribution and clustering behavior

    • Cryo-electron tomography to study glpF in its native membrane environment

  • Microfluidics and Single-Cell Analysis:

    • Microfluidic devices for precise control of environmental conditions during glycerol transport studies

    • Single-cell RNA-seq to capture cell-to-cell variability in glpF expression

    • Time-lapse microscopy with microfluidic switching to monitor acute responses to glycerol availability

  • Biomolecular NMR and Advanced Structural Methods:

    • Solid-state NMR to study glpF dynamics within the membrane

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes during transport

    • Time-resolved crystallography to capture transport intermediates

  • Systems Biology Approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) to place glpF in broader cellular contexts

    • Flux balance analysis to quantify the impact of glpF function on metabolic networks

    • Machine learning to identify complex regulatory patterns from large datasets

What are the most promising approaches for studying glpF in host-pathogen interactions involving P. aeruginosa?

Understanding the role of glpF in P. aeruginosa host-pathogen interactions requires specialized experimental approaches:

  • Infection Model Systems:

    • Tissue Culture Models: Develop polarized airway epithelial cell models to study glpF role during colonization

    • Organoid Systems: Lung or wound organoids to mimic complex tissue environments

    • Animal Models: Compare wild-type and glpF mutant virulence in acute and chronic infection models

    • Ex vivo Systems: Human tissue explants to study glpF contribution to persistence

  • Host Environment Simulation:

    • Artificial Sputum Medium: Study glpF expression and function in cystic fibrosis-like conditions

    • Oxygen Gradient Systems: Examine glpF role in microaerobic and anaerobic infection environments

    • Immune Component Exposure: Investigate glpF response to antimicrobial peptides and phagocyte interaction

  • In vivo Expression Analysis:

    • In vivo Expression Technology (IVET): Identify infection-specific induction of glpF

    • Dual RNA-seq: Simultaneously profile host and pathogen transcriptomes during infection

    • Recombination-based In vivo Expression Technology (RIVET): Detect transient glpF expression during infection stages

  • Interbacterial Competition Studies:

    • Polymicrobial Culture Systems: Study glpF contribution to competition with other microbiome members

    • Bacterial Communication Assessment: Investigate links between glycerol metabolism and quorum sensing

    • Biofilm Competition Assays: Examine glpF role in mixed-species biofilm formation and persistence

  • Antibiotic Tolerance and Persistence:

    • Persister Cell Isolation: Compare glpF expression in persister vs. non-persister subpopulations

    • L-form Induction: Further explore the 144-fold upregulation of glpF in L-forms and its implications for antibiotic tolerance

    • Stress Response Integration: Map connections between glycerol metabolism and stress response pathways

What fundamental questions about glpF remain unanswered and how might researchers address them?

Despite significant advances in understanding glpF, several fundamental questions remain unanswered:

  • Regulatory Mechanism Gaps:

    • Unanswered Question: What are the precise transcription factors and binding sites that control glpF expression?

    • Research Approach: Combine ChIP-seq with promoter dissection through reporter constructs to identify regulatory elements.

    • Unanswered Question: How does the 144-fold upregulation of glpF in L-forms occur at the molecular level?

    • Research Approach: Time-course transcriptomics during L-form transition combined with epigenetic profiling.

  • Structure-Function Relationship Mysteries:

    • Unanswered Question: Which specific residues determine the glycerol selectivity in P. aeruginosa glpF?

    • Research Approach: Systematic alanine scanning mutagenesis combined with functional transport assays.

    • Unanswered Question: Does P. aeruginosa glpF transport molecules beyond glycerol?

    • Research Approach: Liposome-reconstituted transport assays with a panel of potential substrates.

  • Physiological Role Ambiguities:

    • Unanswered Question: Why is glpF essential for L-form formation and persistence?

    • Research Approach: Metabolic tracing with isotope-labeled glycerol to track its fate in L-forms.

    • Unanswered Question: Does glpF play roles beyond glycerol metabolism, such as in stress response?

    • Research Approach: Phenotypic microarrays comparing wild-type and glpF mutants across hundreds of conditions.

  • Evolutionary Puzzles:

    • Unanswered Question: Why has glpF been maintained with such high sequence conservation across diverse bacteria?

    • Research Approach: Comprehensive phylogenetic analysis across bacterial phyla combined with ancestral sequence reconstruction.

    • Unanswered Question: Are there environment-specific variants of glpF optimized for different ecological niches?

    • Research Approach: Comparative genomics of environmental vs. clinical isolates of Pseudomonas species.

  • Membrane Organization Questions:

    • Unanswered Question: Does glpF localize to specific membrane domains or interact with other membrane proteins?

    • Research Approach: Fluorescence resonance energy transfer (FRET) studies with labeled membrane components.

    • Unanswered Question: How does membrane composition affect glpF function in P. aeruginosa?

    • Research Approach: Reconstitution in synthetic membranes with varied lipid compositions.

How can researchers leverage glpF knowledge for antimicrobial development against P. aeruginosa?

The essential role of glpF in processes like L-form formation, persistence, and glycerol metabolism presents several opportunities for antimicrobial development:

  • Inhibitor Design Strategies:

    • Structure-based virtual screening to identify compounds that block the glycerol channel

    • Fragment-based drug discovery targeting conserved regions of the glycerol facilitator

    • Peptidomimetic design to disrupt protein-protein interactions essential for glpF function

    • Allosteric inhibitor development to interfere with conformational changes during transport

  • Anti-Persistence Approaches:

    • Given the 144-fold upregulation of glpF in L-forms , targeting this protein could specifically disrupt bacterial persistence mechanisms

    • Developing compounds that prevent the metabolic adaptations associated with glpF upregulation during antibiotic exposure

    • Creating combination therapies that simultaneously target cell wall synthesis and glycerol metabolism

  • Metabolic Vulnerability Exploitation:

    • Designing glycerol analogs that enter through glpF but disrupt downstream metabolism

    • Creating "Trojan horse" compounds that utilize the glycerol uptake pathway to deliver antimicrobial payloads

    • Developing inhibitors that block the interaction between glpF and glycerol kinase, preventing effective glycerol utilization

  • Adjuvant Development:

    • Using glpF inhibitors as antibiotic adjuvants to prevent the metabolic adaptations that lead to tolerance

    • Designing compounds that increase bacterial susceptibility by interfering with glycerol-dependent stress responses

    • Creating agents that specifically target persister cells through their dependence on altered glycerol metabolism

  • Biofilm Dispersal Agents:

    • Exploiting the role of glycerol metabolism in biofilm formation to develop dispersal agents

    • Targeting glpF-dependent signaling pathways that contribute to biofilm development

    • Designing strategies to penetrate biofilm matrices by interfering with glycerol-related extracellular polymeric substances

What biotechnological applications could benefit from engineered P. aeruginosa glpF variants?

Engineered variants of P. aeruginosa glpF could enable several innovative biotechnological applications:

  • Enhanced Bioremediation Systems:

    • GlpF variants with expanded substrate specificity could facilitate uptake of environmental pollutants

    • Engineered P. aeruginosa strains with modified glpF could efficiently metabolize glycerol-related industrial waste

    • Biosensor strains with glpF-reporter fusions could detect specific compounds in contaminated environments

  • Bioproduction Optimization:

    • Overexpression of engineered glpF could enhance glycerol utilization in industrial fermentation processes

    • Modified substrate specificity could enable uptake of non-traditional carbon sources in biomanufacturing

    • Dynamic regulation of engineered glpF could improve metabolic flux control in production strains

  • Membrane Protein Engineering Platforms:

    • The relatively simple structure and high expression levels make glpF an excellent scaffold for designing novel channel proteins

    • GlpF chimeras incorporating functional domains from other transporters could create proteins with novel transport properties

    • Directed evolution of glpF could generate variants with custom selectivity profiles for synthetic biology applications

  • Drug Delivery Systems:

    • Liposomes or polymersomes incorporating purified engineered glpF could enable controlled release of specific molecules

    • Cell-based delivery systems with modified substrate specificity could target therapeutic compounds to specific tissues

    • Engineered glpF variants could improve permeability in artificial cell systems

  • Biosensing Technologies:

    • GlpF-based biosensors could detect glycerol and related compounds with high sensitivity

    • Protein engineering could create variants responsive to specific analytes through conformational changes

    • Immobilized glpF variants on electrochemical sensors could enable rapid detection in field applications

How might further research on glpF contribute to our understanding of membrane protein evolution and function?

Further research on glpF offers valuable opportunities to enhance our understanding of membrane protein evolution and function:

  • Evolutionary Adaptation Case Study:

    • The 70% sequence identity between P. aeruginosa and E. coli glpF provides an excellent model for studying how membrane proteins adapt to different cellular environments while maintaining core functionality

    • Comparing glpF across Pseudomonas strains from diverse habitats could reveal how environmental pressures shape membrane protein evolution

    • Ancestral sequence reconstruction could illuminate the evolutionary trajectory of glycerol facilitators

  • Structure-Function Relationship Model:

    • The relatively simple function of glpF (passive transport of a specific substrate) makes it an ideal system for mapping how sequence variations affect transport properties

    • Systematic mutagenesis studies could establish comprehensive sequence-function relationships

    • The interface between channel selectivity and transport efficiency in glpF can serve as a model for understanding fundamental biophysical trade-offs in membrane proteins

  • Membrane Protein Folding Insights:

    • Studying the folding pathway of glpF could provide insights applicable to other membrane proteins

    • Identifying chaperones and membrane insertion factors specific to glpF could expand our understanding of membrane protein biogenesis

    • The stability of glpF in different lipid environments could reveal principles of membrane protein-lipid interactions

  • Regulatory Mechanism Framework:

    • The dramatic upregulation (144-fold) of glpF during L-form transition offers an excellent model for studying extreme expression changes in membrane proteins

    • Investigating how cells coordinate increased production of membrane proteins with membrane biogenesis

    • Understanding how membrane protein expression responds to cellular stress

  • Convergent Evolution Analysis:

    • Comparing glycerol transport mechanisms that evolved independently in different lineages

    • Identifying common solutions to the biophysical challenges of selective transmembrane transport

    • Examining how different protein architectures can achieve similar functional outcomes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.