Recombinant Pseudomonas aeruginosa Glycosyltransferase alg8 (alg8)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Alg8

Alg8 is a membrane-bound glycosyltransferase (GT) belonging to the GT-2 family, encoded by the alg8 gene in P. aeruginosa. Recombinant Alg8 refers to the protein produced via heterologous expression systems (e.g., E. coli or P. aeruginosa mutants) to study its structure, function, and role in alginate polymerization . Its overexpression has been linked to dramatic increases in alginate production, making it a focal point for biofilm-related research .

Molecular Structure and Topology

Alg8 is predicted to have five transmembrane (TM) domains, with a large cytoplasmic loop housing its catalytic site . Key structural features include:

Domain/RegionCharacteristics
Cytoplasmic Loop (C1)Contains GT-A fold with conserved motifs: D133, DxD (D188-D190), D296, and LxxRW .
Transmembrane DomainsTM1 (residues 12–34) resembles a cleavable signal peptide; TM5 (472–494) critical for polymerization .
C-TerminusLocalized periplasmically; essential for enzymatic activity .

PhoA fusion studies confirmed that truncations of the C-terminal TM domain abolished alginate production, highlighting its structural necessity .

Functional Role in Alginate Biosynthesis

Alg8 catalyzes the polymerization of GDP-mannuronic acid into alginate chains. Key findings:

  • Enzyme Localization: Active in the cell envelope fraction, requiring interaction with cytoplasmic and outer membranes .

  • Co-polymerase Role: Works with Alg44, which binds c-di-GMP to activate polymerization .

  • Bottleneck Effect: Overexpression of alg8 in trans increased alginate production by 15–20-fold, suggesting Alg8 limits biosynthesis rates .

Enzymatic Activity and Catalytic Mechanism

Site-directed mutagenesis identified critical residues for Alg8’s GT activity:

ResidueRoleImpact of Alanine Substitution
D133, D190Part of DxD motif; nucleotide bindingAbolished polymerization .
D296Acid-base catalysisUnstable protein; loss of activity .
L336, R339LxxRW motif; substrate coordinationReduced alginate production .

The cytoplasmic loop’s GT-A fold facilitates mannuronic acid transfer, while c-di-GMP binding to Alg44 induces conformational changes that activate Alg8 .

Genetic Engineering and Overexpression Studies

Complementation of alg8 knockout mutants restored alginate production and revealed:

Strain/ConstructAlg8 ExpressionAlginate Yield (g/g CDW)Key Observation
P. aeruginosa PDO300Δalg8 (vector)None0Non-mucoid phenotype .
PDO300Δalg8(pBBR1MCS-5:alg8)Overexpressed2.520-fold increase vs. wild type .
PDO300 (wild type)Native0.12Baseline production .

Overexpression also altered alginate composition, reducing guluronic acid content from 38% to 19% .

Impact on Alginate Polymer Composition

Recombinant Alg8 overexpression modifies polymer properties:

  • Acetylation: Increased from 4.7% to 9.3% .

  • Epimerization: Guluronic acid residues decreased by 50%, suggesting impaired epimerase (AlgG) interaction .

Detection and Presence in Clinical Isolates

PCR-based screening of clinical P. aeruginosa isolates (urine, sputum, pus) confirmed universal presence of alg8 and alg44 genes, underscoring their conserved role in virulence .

Research Implications and Future Directions

  • Biofilm Regulation: Targeting Alg8-c-di-GMP interactions could disrupt biofilm formation in chronic infections .

  • Biotechnological Applications: Engineered Alg8 variants may optimize alginate production for industrial use .

  • Unresolved Questions: Mechanisms linking Alg8 to acetylation/epimerization remain unclear, warranting structural studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
alg8; PA3541; Mannuronan synthase; Glycosyltransferase Alg8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-494
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
Target Protein Sequence
MMETYKRGLAEATGWLVFLSLLMVLALAVPKTVFDADSKDFILLIGAVGIWRYSMGGVHF LRGMLFLHVVYPYYRRRVRQLGSAADPSHVFLMVTSFRIDALTTAMVYRSVIREAIDSGY PTTVVCSIVEMSDEVLVRSLWEKMNPPDRVSLDFVRIPGTGKRDGLAYGFRAISRHLPDD DAVVAVIDGDTVLDHGVVKKTVPWFKLFPNVGGLTTNEFCEVQGGYVMSEWHKLRFAQRH INMCSMALSKRVLTMTGRMSVFRARVVTNPEFITDVENDHLEHWRLGRFKFLTGDDKSSW FSLMRLGYDTFYVPDAAINTVEHPPEKSFIKASRKLMYRWYGNNLRQNSRALKLGARRLG WFTMLVLFDQRVSMWTSLLGLVVAILASLKYSIAFLLVYLLWIGLTRLVLTLLLSLSGHR IGPAYPLILYYNQIVGALVKIYVFFRLDRQSWTRQPTKLERGLASFQRWFNAWSSRAMTF SAASIFVAVLLTIV
Uniprot No.

Target Background

Function
Processive enzyme that polymerizes GDP-mannuronic acid.
Gene References Into Functions
  1. Research suggests that c-di-GMP-mediated activation of alginate polymerization involves amino acids located at two loops, including H323 (loop A) and T457 and E460 (loop B), surrounding the catalytic site in the predicted model. PMID: 28258142
Database Links

KEGG: pae:PA3541

STRING: 208964.PA3541

Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Alg8 in Pseudomonas aeruginosa?

Alg8 serves as the catalytic subunit of the alginate polymerase complex in Pseudomonas aeruginosa. Research utilizing isogenic knockout mutants has conclusively demonstrated that Alg8 is essential for alginate biosynthesis. When the alg8 gene is deleted in alginate-overproducing strains such as P. aeruginosa FRD1 and P. aeruginosa PDO300, alginate production is completely abolished, resulting in a non-mucoid phenotype. The enzymatic function can be restored by complementation with only the alg8 gene, confirming its critical role in the polymerization process .

Unlike other alginate biosynthesis genes whose deletion results in the secretion of uronic acid oligomers (due to degradation by alginate lyase AlgL), alg8 deletion mutants show no detectable uronic acid production, indicating that Alg8 functions at the initial polymerization stage rather than in polymer modification or export .

Where is Alg8 localized within the bacterial cell structure?

Alg8 is a membrane-bound protein specifically localized to the cytoplasmic membrane of Pseudomonas aeruginosa. Protein topology prediction algorithms and experimental evidence from fusion protein analysis have confirmed that Alg8 maintains a periplasmic C-terminus orientation. This localization has been verified through subcellular fractionation studies, which demonstrated that the highest specific PhoA activity of Alg8-PhoA fusion proteins is present in the cytoplasmic membrane fraction .

The membrane localization is consistent with Alg8's role in the polymerization and translocation of alginate across the cell envelope. The polymerase complex appears to require both cytoplasmic and outer membrane proteins to function properly, as the highest specific alginate polymerase activity is detected in the envelope fraction containing both membrane components .

How can researchers effectively generate and confirm alg8 deletion mutants in Pseudomonas aeruginosa?

To generate alg8 deletion mutants, researchers should employ the following methodological approach:

  • Amplify the flanking regions of the alg8 gene using PCR with specific primers (e.g., alg81N-Ec5, alg81N-Ba, alg82C-Ba, and alg82C-Ec5).

  • Insert a gentamicin resistance cassette (aacC1 gene) flanked by FRT (Flp recombinase target) sites between these flanking regions.

  • Transfer the constructed deletion vector (e.g., pEX100TΔalg8Gm) into P. aeruginosa strains using a donor strain like E. coli S17-1.

  • Select transconjugants on media containing gentamicin and sucrose to identify double-crossover events.

  • Confirm gene replacement using PCR with primers that flank the deleted region.

  • Optionally, remove the gentamicin cassette by introducing a Flp recombinase-encoding vector (pFLP2) and selecting on sucrose-containing media .

Confirmation of successful alg8 deletion should include:

  • PCR verification of the deletion

  • Phenotypic assessment (non-mucoid colony morphology)

  • Testing of culture supernatants for absence of alginate production using carbazole assay

  • Verification that no uronic acid oligomers are detectable after dialysis/ultrafiltration of culture supernatants

What is the most effective method for establishing an in vitro alginate polymerization assay?

The most effective in vitro alginate polymerization assay utilizes 14C-labeled GDP-mannuronic acid as the activated alginate precursor substrate. The detailed methodology includes:

  • Prepare subcellular fractions from alginate-overproducing P. aeruginosa strains (e.g., FRD1) through differential centrifugation to obtain envelope fractions, cytoplasmic membrane, and outer membrane proteins.

  • Conduct polymerization reactions containing:

    • Subcellular fraction (as the polymerase source)

    • 14C-labeled GDP-mannuronic acid substrate

    • Appropriate buffer conditions

    • Cofactors as needed

  • Incubate the reaction mixture at 30°C for 60 minutes.

  • Terminate the reaction and separate polymerized alginate from unincorporated substrate.

  • Quantify radioactivity in the polymerized fraction to determine enzymatic activity .

This assay reveals that the highest specific alginate polymerase activity is detected in the envelope fraction, indicating that both cytoplasmic and outer membrane proteins are required for optimal polymerase function. Neither cytoplasmic membrane nor outer membrane proteins alone show detectable polymerase activity .

How does overexpression of Alg8 affect alginate production and polymer characteristics?

Overexpression of Alg8 dramatically increases alginate production while simultaneously altering the polymer's chemical composition and physical properties. The data below summarizes these effects:

Table 1: Effects of Alg8 Overexpression on Alginate Production and Composition

ParameterP. aeruginosa PDO300 (control)P. aeruginosa PDO300Δalg8(pBBR1MCS-5:alg8)
Alginate yieldBaseline20-fold increase
Cellular dry mass100%Reduced to 54% ± 10%
Degree of acetylation4.7%Increased to 9.3%
Guluronic acid content38%Reduced to 19%
Alginate per g of cellular dry weight~0.12 g~2.5 g

The significant increase in alginate production when Alg8 is overexpressed provides compelling evidence that Alg8 represents the rate-limiting step in alginate biosynthesis. Remarkably, even C-terminally tagged fusion proteins of Alg8 (with hexahistidine, PhoA, GFP, or LacZ) maintain this capacity for enhanced alginate production, suggesting that the C-terminus modification does not interfere with catalytic function .

The altered polymer composition (increased acetylation and decreased guluronic acid content) indicates that Alg8 overexpression not only affects polymerization rate but also influences downstream modification processes, though the precise mechanism remains to be elucidated .

What structural features of Alg8 are critical for its glycosyltransferase activity?

Alg8 belongs to the glycosyltransferase family 2 (GT-2), characterized by a specific structural organization that is critical for its catalytic function. Based on structural modeling using SpsA from Bacillus subtilis as a template, several key structural features have been identified:

  • A catalytic core with a Rossmann-like fold typical of nucleotide-binding domains

  • DXD motif critical for coordinating divalent cations (typically Mg²⁺ or Mn²⁺) required for nucleotide sugar binding

  • Transmembrane domains that anchor the protein in the cytoplasmic membrane

  • A periplasmic C-terminus that likely interacts with other components of the alginate biosynthesis machinery

Researchers investigating structure-function relationships should consider site-directed mutagenesis of these key regions to evaluate their contribution to catalytic activity. The DXD motif is particularly important to target, as it is highly conserved among GT-2 family members and essential for coordinating metal ions that facilitate the departure of the leaving group during glycosyl transfer .

The membrane localization of Alg8 suggests that it not only functions in polymerization but may also participate in the translocation of the growing alginate chain across the cytoplasmic membrane, similar to other class II glycosyltransferases involved in exopolysaccharide biosynthesis .

How can researchers optimize heterologous expression systems for producing recombinant Alg8?

Optimizing heterologous expression of recombinant Alg8 presents several challenges due to its membrane-bound nature and complex functional requirements. A comprehensive approach should include:

  • Vector selection: Broad-host-range vectors like pBBR1MCS-5 have proven effective for complementation studies. These vectors provide moderate copy numbers and stability in Pseudomonas species .

  • Promoter considerations: The lac promoter has been successfully used to drive alg8 expression. For higher expression levels, stronger inducible promoters such as Ptac may be considered, though potential toxicity from overexpression should be monitored.

  • Fusion tag strategies: C-terminal tags (hexahistidine, PhoA, GFP, LacZ) have been demonstrated to maintain Alg8 functionality while facilitating purification and localization studies. The data indicates that C-terminal modifications do not impair polymerase activity .

  • Host strain selection:

    • For functional studies: P. aeruginosa PDO300Δalg8 provides a clean genetic background

    • For protein production: Consider using E. coli strains optimized for membrane protein expression (C41/C43)

    • Caution: Stability issues have been reported with clinical isolate P. aeruginosa FRD1

  • Expression conditions:

    • Induce expression at lower temperatures (16-20°C) to facilitate proper membrane insertion

    • Include appropriate antibiotics for plasmid maintenance (e.g., gentamicin at 300 μg/ml)

    • Monitor growth parameters, as Alg8 overexpression reduces cellular dry mass by approximately 46%

How might modulating Alg8 activity impact biofilm formation and antibiotic resistance in Pseudomonas infections?

Alg8 represents a promising target for anti-biofilm strategies due to its critical role in alginate biosynthesis. Alginate is a key component of the extracellular polymeric matrix in mucoid P. aeruginosa strains, particularly those isolated from cystic fibrosis patients. Research approaches to explore Alg8 modulation should include:

  • Development of small molecule inhibitors targeting the catalytic domain of Alg8, potentially interfering with GDP-mannuronic acid binding or polymerization activity.

  • Investigation of the relationship between alginate composition and antibiotic penetration. The finding that Alg8 overexpression alters alginate acetylation and guluronic acid content suggests that these modifications could affect matrix properties and antibiotic diffusion .

  • Evaluation of combinatorial approaches using Alg8 inhibitors with conventional antibiotics to overcome the protective barrier function of alginate in biofilms.

  • Assessment of how Alg8-mediated changes in alginate production affect bacterial susceptibility to host immune defenses, as alginate overproduction is known to protect P. aeruginosa from phagocytosis and oxidative killing.

The identification of Alg8 as the bottleneck in alginate biosynthesis provides a rational target for anti-virulence strategies that could reduce biofilm formation without directly killing bacteria, potentially reducing selective pressure for resistance development .

What experimental approaches can determine the interactions between Alg8 and other components of the alginate biosynthesis machinery?

Investigating the protein-protein interactions within the alginate biosynthesis complex requires sophisticated methodological approaches:

  • In vivo crosslinking: Chemical crosslinkers of varying arm lengths can be used to capture transient interactions between Alg8 and other components of the biosynthesis machinery. After crosslinking, complexes can be isolated using the C-terminal tags on Alg8 (hexahistidine) that have been shown not to interfere with function .

  • Co-immunoprecipitation studies: Using antibodies against Alg8 or its fusion tags to pull down associated proteins, followed by mass spectrometric identification of interacting partners.

  • Bacterial two-hybrid systems: Modified for membrane proteins to identify binary interactions between Alg8 and other components of the alginate biosynthesis operon.

  • Fluorescence resonance energy transfer (FRET): Using fluorescently tagged Alg8 (the GFP fusion has been shown to be functional ) and other suspected interaction partners to monitor protein-protein interactions in real-time within living cells.

  • Subcellular fractionation and activity reconstitution: The finding that alginate polymerase activity requires both cytoplasmic and outer membrane components suggests a multi-protein complex spanning the cell envelope. Systematic reconstitution experiments with purified components can help define the minimal functional complex .

These approaches can help elucidate the architecture of the complete alginate biosynthesis complex and potentially identify additional regulatory mechanisms controlling alginate production beyond the rate-limiting step provided by Alg8.

What are the common challenges in maintaining plasmid stability when overexpressing Alg8 in Pseudomonas strains?

Plasmid stability issues have been documented when overexpressing Alg8, particularly in clinical isolates like P. aeruginosa FRD1 . Researchers should consider several approaches to address these challenges:

  • Vector selection: Broad-host-range vectors such as pBBR1MCS-5 have demonstrated reasonable stability in laboratory strains like P. aeruginosa PDO300, but may exhibit instability in clinical isolates .

  • Antibiotic selection pressure: Maintain appropriate antibiotic concentrations throughout cultivation. Note that gentamicin itself can increase alginate production approximately two-fold in P. aeruginosa PDO300(pBBR1MCS-5), which should be accounted for in experimental controls .

  • Strain considerations: The research indicates that P. aeruginosa PDO300 is more amenable to stable plasmid maintenance than clinical isolate FRD1. When working with FRD1, genomic integration of the alg8 gene may be preferable to plasmid-based expression .

  • Growth conditions: The significant metabolic burden imposed by Alg8 overexpression (reducing cellular dry mass to approximately 54% of control levels) may create selective pressure against plasmid maintenance. Consider using inducible promoters and optimizing induction timing and strength .

  • Regular verification: Implement routine PCR verification of plasmid presence and sequence integrity throughout extended cultivation periods, especially for experiments requiring multiple generations of growth.

How can researchers effectively analyze and characterize the alginate polymers produced by recombinant Alg8 systems?

Comprehensive characterization of alginate polymers requires multiple analytical techniques:

Table 2: Analytical Methods for Alginate Characterization

Analytical MethodInformation ProvidedTechnical Considerations
Carbazole assayQuantification of total uronic acidsSimple colorimetric assay for routine quantification
1H-NMR spectroscopyDetermination of M/G ratio and degree of acetylationRequires purified alginate; provides detailed structural information
Size exclusion chromatographyMolecular weight distributionConsider using multi-angle light scattering detection for absolute MW determination
Rheological analysisViscosity, gel-forming propertiesProperties strongly dependent on M/G ratio and acetylation
Circular dichroismSecondary structure of the polymerUseful for characterizing conformational changes
Elemental analysisC/H/O ratios and purityCan help detect contaminating polysaccharides

When analyzing alginate from recombinant systems overexpressing Alg8, researchers should pay particular attention to:

  • Changes in the degree of acetylation (increased from 4.7% to 9.3% in complemented mutants)

  • Alterations in guluronic acid content (reduced from 38% to 19% in complemented mutants)

  • The impact of these compositional changes on physical properties such as viscosity, gel strength, and water retention capability

These analytical approaches will provide comprehensive characterization of how Alg8 overexpression impacts not only the quantity but also the quality and functional properties of the alginate produced.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.