Recombinant Pseudomonas aeruginosa Heme exporter protein B (ccmB)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

CcmB (encoded by PA1476 in P. aeruginosa PAO1) is a 23.4 kDa membrane protein with an isoelectric point (pI) of 8.53 . Key attributes include:

AttributeValue/Description
Gene locusPA1476 on the chromosome (1602877–1603548, + strand)
SynonymsHelB, Cyt10, CycW
UniProtKB IDQ9I3N6
Molecular functionHeme translocation from the cytoplasmic membrane
Conserved domainsABC transporter transmembrane region

Functional Role in Heme Export

CcmB operates as part of the CcmABCD complex in P. aeruginosa and other System I bacteria. Its primary roles include:

  • Heme translocation: CcmB exports cytoplasmic heme to the periplasm for covalent attachment to apocytochrome c .

  • Complexation with CcmACD: Binding to CcmACD restricts heme usage exclusively to CCM, preventing leakage .

  • Membrane origin: CcmB extracts heme directly from the cytoplasmic membrane, akin to HrtAB in Corynebacterium diphtheriae .

Key experimental findings:

  • Overexpression of ccmB in Escherichia coli leads to extracellular heme accumulation, confirming its efflux activity .

  • Mutational studies (e.g., CcmA E163Q) showed that conformational changes in the CcmAB complex do not affect CcmB-mediated heme export .

  • CcmB homologs from E. coli, Rhodobacter capsulatus, and other System I bacteria share conserved heme-exporting activity, though P. aeruginosa CcmB exhibits higher efficiency .

Comparative Analysis with HrtAB

CcmB and HrtAB (C. diphtheriae) both expel heme from the membrane but differ in efficiency and regulatory mechanisms:

FeatureCcmBHrtAB
Primary roleCytochrome c maturationHeme detoxification
Membrane interactionDirect heme extraction from the membraneEfflux from the cytoplasm
Induction efficiencyHigher toxicity relief at lower expressionRequires stronger induction for effect
ConservationSystem I bacteriaGram-positive pathogens

Data from indicate that P. aeruginosa CcmB outperforms HrtAB in mitigating heme toxicity when expressed in E. coli .

Applications and Research Implications

  • Biotechnological use: Recombinant CcmB production in heterologous hosts (e.g., E. coli) enables studies on heme transport mechanisms .

  • Antimicrobial targeting: Disrupting CcmB could impair cytochrome c maturation, offering a pathway for novel antibiotics .

Conservation and Evolutionary Context

CcmB homologs are widespread in System I bacteria but absent in archaea, viruses, or non-System I organisms . Evolutionary analyses suggest that lateral gene transfer may explain its sporadic distribution in environmental and pathogenic strains .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it based on your request.
Synonyms
ccmB; PA1476; Heme exporter protein B; Cytochrome c-type biogenesis protein CcmB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-223
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
ccmB
Target Protein Sequence
MSNVFSLLLAREARLLFRRPAELANPLVFFAIVIALFPLAVGPESQLLQTLSPGLVWVAA LLAVLLSLEGLFRSDFEDGSMEQWVLSPHPLALLVLAKVLAHWLFSGLALVLMSPLFALM LGLPARCIPVLLLSLLLGTPVLSLLGAVGAALTVGLKRGGLLLALLILPLYIPVLILGSG ALQASLQGLPSSGHLLWLASLTALALTLTPFAIAAGLKISVGE
Uniprot No.

Target Background

Function
Essential for the export of heme to the periplasm, a critical step in the biogenesis of c-type cytochromes.
Database Links

KEGG: pae:PA1476

STRING: 208964.PA1476

Protein Families
CcmB/CycW/HelB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is CcmB and what is its role in Pseudomonas aeruginosa?

CcmB is a critical membrane protein in Pseudomonas aeruginosa that functions as a heme translocase. It serves as the essential component that translocates heme across the bacterial membrane and is part of the Cytochrome C Maturation (CCM) system. Within this system, CcmB works in complex with other proteins (CcmA, CcmC, and CcmD) to ensure proper heme trafficking, which is crucial for cytochrome maturation and ultimately bacterial respiration and energy production. The identification of CcmB as a heme translocase has filled a significant gap in our understanding of the CCM pathway .

How does CcmB fit into the larger Cytochrome C Maturation (CCM) pathway?

CcmB functions as part of the CcmABCD complex in the System I Cytochrome C Maturation pathway. Within this complex, CcmB translocates heme across the membrane, while CcmC binds and delivers the heme to CcmE, which serves as a heme chaperone. The coordination between these components is critical - CcmB facilitates the movement of heme, while its complexation with CcmACD ensures that the translocated heme is specifically directed toward cytochrome c maturation rather than being lost or used in other cellular processes. This orderly transfer of heme is essential for the proper assembly of c-type cytochromes, which are vital electron transfer proteins in bacterial respiratory chains .

Why is studying CcmB in Pseudomonas aeruginosa particularly important?

Pseudomonas aeruginosa is a significant opportunistic pathogen responsible for acute nosocomial infections and chronic respiratory infections, particularly in cystic fibrosis patients. Strain-specific differences in this bacterium correlate with variations in clinical outcomes, highlighting the importance of understanding the genetic factors that enable infection, virulence, or antibiotic resistance . As a component of the essential CCM system, CcmB represents a potential target for novel antimicrobial strategies. Additionally, P. aeruginosa exhibits high intrinsic levels of antibiotic resistance, with some strains (like CRPA) being resistant to carbapenem antibiotics, making infection control increasingly challenging . Understanding the fundamental biological processes mediated by proteins like CcmB could reveal new therapeutic vulnerabilities.

What is the structural composition of the CcmB protein?

The CcmB protein has a complex membrane-embedded structure that has been revealed through cryo-EM studies and computational prediction methods. Each CcmB monomer forms a six-transmembrane (TM) helix bundle, with two cytoplasmic α-helices (CH1 and CH2) associated with the cytoplasmic side of the membrane and oriented parallel to it. During dimerization, two CcmB monomers assemble into a rigid 12-helix bundle. The structural similarity between cryo-EM determined structures (PDB ID: 7F02) and AlphaFold2 (AF2) predictions demonstrates the stability of this conformation . The transmembrane helices form the core structural elements through which heme is transported, while the cytoplasmic helices are believed to play regulatory roles.

What key residues are essential for CcmB function and structure?

Multiple conserved residues have been identified as crucial for CcmB function through alanine scanning analysis. These include:

Protein RegionCritical ResiduesFunctional Impact When Mutated
Cytoplasmic Helix 1 (CH1)D18Retains CCM activity but loses ability to impair the process when overproduced
Transmembrane Helix 2 (TM2)R76, K79Retains CCM activity but loses ability to impair the process when overproduced
Transmembrane Helix 4 (TM4)L141, T145Retains CCM activity but loses ability to impair the process when overproduced
Transmembrane Helix 5 (TM5)L181, P175, P179P175 and P179 variants unable to complement CcmB loss; L181 retains CCM activity but loses inhibitory function

These residues are distributed throughout the protein, indicating that all helices contribute significantly to CcmB function .

How does the structural dynamics of CcmB relate to its function?

Particularly, the F78/K79 region in TM2 exhibits functional importance. Double mutations (F78A/K79A) alter the protein's behavior, increasing the flexibility of the surrounding region and changing motion correlation patterns in local areas. This suggests that these residues play a crucial role in regulating the conformational changes required for heme transport. Additionally, residues 21-24 of CH1 and 75-79 of TM2 show higher flexibility than neighboring regions, indicating they may contribute to dynamic processes during heme translocation .

What is the mechanism of heme translocation by CcmB?

The mechanism of heme translocation by CcmB involves a cavity located near the cytoplasmic side of the membrane, surrounded by TM1, TM2, and TM3, as well as CH1 of each CcmB monomer. Within this cavity, a portion of TM2 (particularly residues F78 and K79) extrudes into the space. The location of this cavity is consistent with the known behavior of heme to intercalate into lipid bilayers .

The translocation process likely begins at a small triangular opening that serves as an entrance to the cavity. This opening is surrounded by CH1, TM1, and TM3 of each monomer and is exposed to the hydrophobic interior of the membrane. This structural arrangement suggests a pathway through which heme molecules can be transported from the cytoplasmic side across the membrane .

Importantly, when CcmB is complexed with CcmACD, the helix-bundle structure becomes tightly packed, which appears to inhibit heme expulsion. This indicates that the regulation of CcmB's conformation through protein-protein interactions is critical for controlling heme transport direction and efficiency .

How does the interaction between CcmB and CcmC affect heme transport?

The interaction between CcmB and CcmC is crucial for regulating heme transport. CcmC contains key histidine residues (H60 and H184) that are essential for heme binding. When CcmB is produced alongside CcmC variants where these heme-binding residues are replaced with alanine (CcmC H60A and CcmC H184A), the ability of CcmC to inhibit heme efflux is impaired .

In contrast, when CcmB is produced with CcmC variants where non-critical residues are replaced (CcmC D126A and CcmC R128A), the behavior is similar to wild-type CcmC. This demonstrates that the ability of CcmC to bind heme is directly linked to its capability to regulate CcmB-mediated heme transport .

This relationship illustrates how the CcmABCD complex coordinates heme trafficking - CcmB translocates heme across the membrane, while CcmC captures and directs it toward CcmE for subsequent steps in the cytochrome c maturation pathway. The physical interactions between these proteins create a controlled pathway that prevents heme from being inappropriately released.

What happens when CcmB is overexpressed in bacterial cells?

Overexpression of CcmB leads to interesting functional consequences. When CcmB is produced at high levels without proportional increases in its partner proteins (CcmA, CcmC, and CcmD), it appears to cause uncoupled heme efflux - essentially functioning as an unregulated heme transporter rather than as part of the coordinated CCM system .

This suggests that the stoichiometric balance between CcmB and its partner proteins is critical for proper function. In normal conditions, the formation of the CcmABCD complex ensures that heme translocation by CcmB is tightly coupled to downstream processing by other CCM components. When this balance is disrupted through overexpression of CcmB alone, the unpartnered CcmB molecules can transport heme across the membrane in a manner that is not productive for cytochrome maturation .

Specific mutations in CcmB (such as at positions D18, R76, K79, L141, T145, and L181) create variants that retain CCM activity but lose this inhibitory function when overproduced, highlighting the structural basis for regulated versus unregulated transport .

What techniques are most effective for studying CcmB structure and function?

Multiple complementary techniques have proven effective for investigating CcmB:

  • Cryo-electron microscopy (cryo-EM): Has been used to determine the structure of CcmB within the CcmABCD complex (PDB ID: 7F02), providing insights into the protein's membrane-embedded architecture .

  • Computational prediction methods: AlphaFold2 (AF2) predictions have been used to model CcmB structure, showing high similarity to experimentally determined structures and providing additional conformational insights .

  • Molecular dynamics (MD) simulations: Essential for understanding the dynamic behavior of CcmB, revealing regions of flexibility and conformational changes that may be important for function. Specific analyses include RMSF (root-mean-square fluctuation), RMSD (root-mean-square deviation), DCCM (dynamic cross-correlation matrix), and DSSP (dictionary of secondary structure of protein) .

  • Site-directed mutagenesis: Alanine scanning of conserved residues has been crucial for identifying functionally important regions of CcmB. This approach has revealed residues essential for CCM activity versus those involved in regulating heme efflux .

  • Complementation assays: Used to assess whether mutant versions of CcmB can restore function in strains lacking the native protein, helping to distinguish essential from non-essential features .

  • Protein expression and purification: Required for biochemical and structural studies, allowing for in vitro analysis of protein properties and interactions.

What are the challenges in expressing and purifying recombinant CcmB?

Expressing and purifying recombinant CcmB presents several challenges common to membrane proteins:

These challenges necessitate optimization of expression systems, purification protocols, and functional assays specific to CcmB research.

How can researchers effectively design mutation studies to understand CcmB function?

Effective mutation studies for CcmB should follow these methodological guidelines:

  • Target conserved residues: Focus on perfectly or highly conserved residues across CcmB homologs from different bacteria hosting System I CCM. Sequence alignment of CcmB proteins from representative organisms can identify these conserved positions .

  • Consider structural context: Use structural information to select residues based on their location in functional regions, such as those lining potential heme-binding cavities or at protein-protein interfaces.

  • Systematic scanning: Apply alanine scanning across multiple protein regions to comprehensively map functional domains. The research has demonstrated that this approach successfully identified 28 conserved residues with varying functional impacts .

  • Create functional categories of mutations: Distinguish mutations that:

    • Completely abolish CcmB function (e.g., P175A and P179A in TM5)

    • Retain CCM activity but lose regulatory properties (e.g., D18A, R76A, K79A)

    • Have minimal impact on function (structurally tolerant positions)

  • Test double mutations: Examine specific residue pairs that may work cooperatively, as demonstrated with the F78A/K79A double mutant, which showed enhanced heme efflux compared to single mutants .

  • Employ complementary assays: Use both complementation assays (to test basic function) and overexpression studies (to test regulatory properties) to distinguish different aspects of CcmB function .

  • Validate with structural dynamics: Follow up interesting mutations with MD simulations to understand how they alter protein dynamics and potential mechanisms of action .

How does genomic variation in ccmB influence P. aeruginosa strain-specific phenotypes?

The genomic variation in the ccmB gene could contribute to strain-specific differences in P. aeruginosa through several mechanisms:

  • Recombination effects: P. aeruginosa genomes show evidence of frequent recombination, typically involving short stretches of DNA (200-300 bp). This recombination contributes significantly to nucleotide diversity alongside mutations . Such recombination events affecting the ccmB gene could introduce strain-specific variations that alter protein function or regulation.

  • Strain adaptation: Different strains of P. aeruginosa are associated with distinct clinical outcomes, particularly in cystic fibrosis patients . Variations in CcmB that affect cytochrome maturation efficiency could influence respiratory capacity, which might in turn affect growth rates, biofilm formation, or virulence factor production.

  • Antibiotic resistance connections: Some P. aeruginosa strains exhibit carbapenem resistance (CRPA) . While CcmB is not directly an antibiotic target, alterations in respiratory chain assembly could potentially influence cellular metabolism and indirectly affect antibiotic susceptibility or tolerance mechanisms.

  • Host adaptation: Strains that have adapted to specific host environments (such as the CF lung) might show specialized adaptations in CCM pathway proteins, including CcmB, to optimize function under the particular constraints of their niche.

To investigate these connections, researchers would need to conduct comparative genomic analyses of ccmB sequences across diverse clinical isolates, combined with functional characterization of the resulting protein variants.

What is the potential for contradictions in CcmB research data and how should they be analyzed?

Contradictions in CcmB research data might arise from several sources and can be analyzed using approaches inspired by Plithogenic Cognitive Map (PCM) methodology, which helps manage contradictory information in decision-making :

  • Structural versus functional contradictions: Structural studies might suggest a specific mechanism for CcmB function, while functional assays might indicate different behavior. For example, the tight packing of CcmB in cryo-EM structures seems contradictory to its role as a transporter . Researchers should:

    • Document the contradiction degree between structural and functional data

    • Use linguistic representation of contradiction levels (e.g., "highly contradictory," "partially contradictory")

    • Develop models that accommodate both perspectives where possible

  • In vitro versus in vivo contradictions: CcmB behavior in purified systems might differ from its activity in living cells. Researchers should:

    • Explicitly compare results across different experimental contexts

    • Consider cellular factors that might resolve apparent contradictions

    • Develop a contradiction matrix that maps the degree of alignment between different experimental approaches

  • Model-dependent interpretations: Different computational models might yield contradictory predictions about CcmB dynamics. Researchers should:

    • Compare RMSD, RMSF, DCCM, and DSSP analyses across multiple simulation runs

    • Evaluate the statistical significance of observed differences

    • Consider ensemble approaches that incorporate multiple possible conformational states

  • Cross-species contradictions: CcmB homologs from different bacterial species might show contradictory functional properties. A systematic approach would:

    • Map conservation and variation across homologs

    • Identify core consistent features versus species-specific adaptations

    • Use contradiction degree representations to classify the severity of functional differences

The PCM approach, with its linguistic contradiction degree representations between factors, provides a framework for handling such complex, potentially contradictory data in a systematic way .

How might CcmB interact with other cellular systems beyond the CCM pathway?

While CcmB's primary role is within the CCM pathway, potential interactions with other cellular systems represent an advanced research frontier:

  • Membrane stress response systems: As a membrane protein involved in heme transport, CcmB might interact with systems that respond to membrane stress or damage. Heme is known to cause membrane damage at high concentrations, so CcmB function might be coordinated with stress response pathways.

  • Iron homeostasis networks: Heme contains iron, a limited and potentially toxic nutrient. CcmB-mediated heme transport likely interfaces with iron homeostasis systems, potentially responding to iron limitation or excess through regulatory mechanisms.

  • Redox sensing systems: Cytochromes function in electron transport chains involved in cellular respiration. Changes in redox state might influence CcmB activity through direct or indirect mechanisms, linking respiratory status to CCM pathway activity.

  • Virulence regulation: In pathogens like P. aeruginosa, the expression and function of virulence factors often responds to environmental conditions. If cytochrome maturation influences metabolic capacity or environmental sensing, CcmB activity might indirectly affect virulence factor expression.

  • Transport coordination: CcmB might functionally interact with other membrane transporters to coordinate the movement of various substrates. For example, coordination with iron transport systems would ensure that heme transport matches cellular iron needs.

Investigating these potential interactions would require systems biology approaches, including protein-protein interaction studies, transcriptomic analyses under various conditions, and phenotypic characterization of ccmB mutants beyond cytochrome maturation defects.

How might targeting CcmB function impact P. aeruginosa virulence and antibiotic resistance?

Targeting CcmB function could impact P. aeruginosa in several clinically relevant ways:

  • Metabolic vulnerability: Disrupting CcmB would impair cytochrome maturation, potentially compromising respiratory capacity. This could weaken the bacterium, particularly under the oxygen-limited conditions often found in infections, potentially reducing its ability to establish persistent infections.

  • Synergy with existing antibiotics: Cells with compromised respiratory function might show increased susceptibility to certain antibiotics, particularly those whose efficacy is affected by bacterial energy status or membrane potential. This could provide a strategy for overcoming resistance in challenging strains like CRPA .

  • Biofilm formation: P. aeruginosa forms biofilms that contribute to persistent infections and antibiotic resistance. If cytochrome maturation affects energy production needed for biofilm formation or maintenance, CcmB inhibition might reduce biofilm robustness.

  • Virulence factor production: Many virulence factors require energy for their synthesis and export. Compromised respiratory capacity due to CcmB inhibition might reduce the production of virulence factors, potentially attenuating pathogenicity.

  • Resistance development: Unlike targets of conventional antibiotics, the CCM pathway has not been under selective pressure from clinical antimicrobials. This might make resistance to CcmB-targeting agents slower to emerge, though this would need empirical verification.

Experimental approaches to investigate these possibilities would include assessing virulence factor production, biofilm formation, and antibiotic susceptibility in ccmB mutants or under conditions of CcmB inhibition.

What experimental design considerations are important when studying CcmB in clinical isolates of P. aeruginosa?

When studying CcmB in clinical isolates of P. aeruginosa, researchers should consider:

  • Strain diversity: P. aeruginosa clinical isolates show considerable genetic diversity, with strain-specific differences correlating with clinical outcomes . Experimental designs should include:

    • Multiple isolates representing different lineages and sources (acute vs. chronic infections)

    • Comparisons of epidemic strains with sporadic isolates

    • Sequential isolates from chronic infections to track evolution

  • Growth conditions: Clinical environments differ substantially from laboratory conditions, affecting CCM pathway function:

    • Test multiple media compositions, including those mimicking infection sites

    • Include oxygen limitation conditions common in infection sites

    • Consider biofilm growth models alongside planktonic cultures

  • Genetic manipulation challenges: Clinical isolates may be less genetically tractable than laboratory strains:

    • Optimize transformation protocols for clinical isolates

    • Consider inducible expression systems to control gene dosage

    • Validate genetic constructs in reference strains before moving to clinical isolates

  • Consideration of recombination: P. aeruginosa undergoes frequent homologous recombination that contributes significantly to genetic diversity . When analyzing ccmB sequences:

    • Look for evidence of recombination events affecting the ccmB gene

    • Consider how recombination might have shaped ccmB evolution in different lineages

    • Use appropriate phylogenetic methods that account for recombination

  • Correlation with clinical data: Connect CcmB research to clinical outcomes:

    • Track ccmB sequence variations across isolates from different infection types

    • Correlate functional changes in CcmB with antibiotic resistance profiles

    • Examine associations between CCM pathway variations and patient outcomes

These considerations help ensure that findings about CcmB function in clinical isolates have maximum relevance to understanding P. aeruginosa pathogenesis and developing new therapeutic strategies.

How could structural knowledge of CcmB be leveraged for antimicrobial development?

The structural knowledge of CcmB provides several potential avenues for antimicrobial development:

  • Targeting the heme transport cavity: The identified cavity surrounded by TM1, TM2, TM3, and CH1 represents a potential binding site for small molecule inhibitors . Compounds that occupy this space could block heme transport, disrupting cytochrome maturation. Virtual screening approaches could identify candidates that:

    • Interact with key residues like F78 and K79 that extrude into the cavity

    • Mimic heme structure but cannot be transported

    • Stabilize CcmB in conformations incompatible with transport

  • Disrupting protein-protein interactions: CcmB functions as part of the CcmABCD complex, with complex formation regulating its activity . Molecules that interfere with these interactions could:

    • Prevent complex assembly, leading to unregulated heme efflux

    • Alter the conformation of the complex to inhibit transport

    • Target interface residues identified through structural studies

  • Exploiting dynamic regions: MD simulations have identified regions of CcmB with higher flexibility that may be crucial for function . These dynamically important regions include:

    • Linkers connecting transmembrane helices

    • Flexible regions in CH1 (residues 21-24)

    • The functionally important F78/K79 region

    Molecules that bind to these regions and restrict necessary motions could impair function.

  • Structure-based vaccine development: While challenging for a membrane protein, structural knowledge of surface-exposed regions of CcmB might inform the design of peptide antigens for vaccine development, potentially generating antibodies that interfere with CCM function.

  • Allosteric modulators: Identify allosteric sites in CcmB where binding of small molecules could propagate conformational changes to the active site, indirectly inhibiting function while potentially offering selectivity advantages.

Development of such approaches would require iterative cycles of structure-based design, in vitro validation in recombinant systems, and testing in bacterial cultures to confirm antimicrobial activity and specificity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.