Recombinant Pseudomonas aeruginosa Heme exporter protein C (ccmC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ccmC; PA1477; Heme exporter protein C; Cytochrome c-type biogenesis protein CcmC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
ccmC
Target Protein Sequence
MMNWTWFHKLGSPKWFYEISGRWLPWFAVAAALLIVTGCVWGLAFAPPDYQQGNSFRIIY IHVPAAFLAQSCYVMLAVAGAVGLIWKMKIADVAVQCAAPIGAWMTFVALLTGAVWGKPT WGAWWVWDARLTAMLILLFLYFGIIALGQAISNRDSAAKACAVLAIVGVVNIPIIKYSVE WWNTLHQPATFTITEKPAMPVEMWLPLLIMVLGFYCFFAAMLLVRMRLEVLKRESRTAWA KAEVKALVEKAR
Uniprot No.

Target Background

Function
CcmC plays a crucial role in facilitating heme export to the periplasm, a necessary step for the biosynthesis of c-type cytochromes.
Gene References Into Functions
  1. This study demonstrated that CcmC is a key factor in cytochrome c biogenesis, pyoverdine maturation, and the expression of certain quorum sensing-regulated traits. PMID: 18174132
Database Links

KEGG: pae:PA1477

STRING: 208964.PA1477

Protein Families
CcmC/CycZ/HelC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of ccmC in Pseudomonas aeruginosa?

ccmC is a key component of the cytochrome c maturation (Ccm) system in Pseudomonas aeruginosa and other Proteobacteria. It functions as an integral inner-membrane protein essential for the biogenesis of c-type cytochromes. The protein plays a crucial role in heme delivery and attachment to the apocytochrome, which is necessary for proper cytochrome c function. In P. aeruginosa specifically, ccmC has been identified as a critical determinant for cytochrome c biogenesis, with mutations in this gene resulting in complete abrogation of cytochrome c production .

How does ccmC relate to other components of the Ccm system?

ccmC operates within the ccmABCDEFG(H) gene cluster that encodes proteins essential for c-type cytochrome maturation. While all these components work together in the biogenesis pathway, ccmC appears to have a uniquely central role. Research indicates that ccmC interacts closely with other Ccm proteins to form a functional complex that facilitates heme transport and attachment. Among the Ccm proteins, mutations in ccmC produce the most dramatic and widespread phenotypic changes, suggesting it may function as a key regulatory or structural component within the complex .

What phenotypic changes occur when ccmC is inactivated in P. aeruginosa?

Inactivation of ccmC in P. aeruginosa leads to a cascade of phenotypic alterations far beyond just cytochrome c deficiency:

PhenotypeEffect of ccmC MutationSeverity Compared to Other ccm Mutations
Cytochrome c productionCompletely abrogatedMost severe (total vs. partial loss)
Pyoverdine productionSeverely reducedMore severe than in ccmF mutants
Growth under iron limitationSeverely restrictedMore pronounced than other ccm mutants
Pyochelin productionIncreasedUnique to ccmC mutations
Pyocyanin productionStrongly affectedMore affected than in ccmF mutants
Motility (swarming/twitching)ReducedSignificant compared to other ccm genes
Rhamnolipid productionDecreasedMore affected than in other ccm mutants
Porphyrin accumulationObservedNot reported in other ccm mutants
Catalase productionUndetectableUnique to ccmC mutants
[Fe-S] cluster contentReducedAlso observed in ccmF mutants but less severe

These extensive changes highlight ccmC's importance beyond cytochrome c maturation, suggesting it plays a central role in multiple cellular processes .

How can non-polar insertions in the ccmC gene be generated for phenotypic studies?

For generating non-polar insertions in the ccmC gene of P. aeruginosa, researchers typically employ site-directed mutagenesis approaches. The methodology involves:

  • Designing flanking primers: Create primers that amplify regions upstream and downstream of the ccmC gene.

  • Insertion cassette preparation: Prepare a selectable marker cassette (commonly gentamicin or kanamycin resistance) with compatible restriction sites.

  • Constructing the mutant allele: Use overlap extension PCR to generate a construct where the resistance cassette is flanked by the upstream and downstream regions.

  • Transfer to suicide vector: Clone the construct into a suicide vector (e.g., pEX100T) that cannot replicate in Pseudomonas.

  • Conjugation or electroporation: Introduce the vector into P. aeruginosa.

  • Selection for double recombinants: Use sucrose counter-selection if the vector contains sacB, or screen for loss of vector-encoded markers.

  • Verification: Confirm the insertion using PCR, sequencing, and phenotypic assays such as cytochrome c staining.

This approach ensures that only the targeted gene is disrupted while preserving the expression of downstream genes in the ccm operon, critical for accurate phenotypic analysis .

What experimental design approaches can distinguish direct from indirect effects of ccmC mutation?

Distinguishing direct from indirect effects requires a multi-faceted experimental approach:

  • Complementation studies: Reintroduce wild-type ccmC (including from related species like P. fluorescens ATCC 17400) on a plasmid to confirm phenotype restoration. Complete reversal indicates the phenotype is directly linked to ccmC loss .

  • Domain-specific mutations: Create targeted mutations in specific functional domains rather than whole-gene knockouts to identify which domains correlate with specific phenotypes.

  • Temporal analysis: Monitor changes in cellular processes over time following controlled ccmC inactivation to establish a sequence of effects.

  • Metabolomic profiling: Compare metabolic profiles between wild-type and ccmC mutants to identify intermediate metabolites that accumulate or decrease, helping trace causal relationships.

  • Protein-protein interaction studies: Use techniques like bacterial two-hybrid systems or co-immunoprecipitation to identify direct interaction partners of CcmC.

  • Transcriptomic comparison: Use RNA-seq to determine if gene expression changes in seemingly unrelated pathways are occurring at the transcriptional level, suggesting regulatory connections.

This comprehensive approach can differentiate between phenotypes directly caused by ccmC absence versus those arising from downstream metabolic or regulatory disruptions .

How does ccmC inactivation affect siderophore production and what mechanisms explain the differential effects on pyoverdine versus pyochelin?

The differential impact of ccmC inactivation on siderophore production is a complex phenomenon:

Pyoverdine production is severely reduced in ccmC mutants while pyochelin production is increased, suggesting interconnected but distinct regulatory mechanisms. The mechanisms likely involve:

  • Heme biosynthesis interference: ccmC mutation disrupts heme delivery, causing accumulation of biosynthetic intermediates (porphyrins). These intermediates may directly interfere with pyoverdine synthetase complex function or alter intracellular iron sensing .

  • Iron homeostasis disruption: Without functional cytochromes, cellular redox state and iron utilization change dramatically. P. aeruginosa likely perceives this as severe iron limitation despite potential iron accumulation in unusable forms.

  • Regulatory cross-talk: The Fur (ferric uptake regulator) system that regulates both pyoverdine and pyochelin may respond differently to the altered iron status in ccmC mutants. The increased pyochelin production suggests a compensatory response to reduced pyoverdine.

  • Energy metabolism constraints: Pyoverdine synthesis requires more cellular resources than pyochelin. With compromised energy generation due to cytochrome deficiency, the cell may favor the less resource-intensive siderophore.

  • Maturation pathway overlap: The pathways for cytochrome c maturation and pyoverdine maturation may share components or regulatory elements beyond the direct role of ccmC.

This complex interrelationship between cytochrome biogenesis and siderophore production indicates that ccmC functions at a crucial nexus of cellular iron management pathways in P. aeruginosa .

What mechanisms explain the link between ccmC function and quorum sensing-regulated traits in P. aeruginosa?

The connection between ccmC and quorum sensing (QS) regulated traits appears to involve intricate regulatory networks:

ccmC mutation affects several QS-regulated phenotypes (pyocyanin production, rhamnolipid synthesis, and motility) without altering production of the key QS signals N-acyl homoserine lactones (AHLs) or Pseudomonas quinolone signal (PQS) . This paradoxical finding suggests:

  • Post-signal production effects: ccmC mutation likely affects processes downstream of signal production, possibly at the level of signal reception, signal transduction, or target gene activation.

  • Metabolic precursor limitation: Many QS-regulated products require metabolic precursors that may become limiting when cellular energy production is compromised by cytochrome c deficiency.

  • Redox state influence: The altered redox state in ccmC mutants may influence the activity of transcription factors that respond to both QS signals and cellular redox conditions.

  • Fe-S cluster connection: The reduced [Fe-S] cluster content observed in ccmC mutants may affect key regulatory proteins that contain Fe-S clusters and modulate QS-dependent gene expression.

  • Integration with stress responses: The cellular stress induced by ccmC mutation may trigger alternative regulatory pathways that override normal QS signal processing.

This complex interplay demonstrates how cellular energetics and redox chemistry integrate with bacterial communication systems, providing insights into the sophisticated regulatory networks controlling virulence in P. aeruginosa .

How do the roles of ccmC differ between various Pseudomonas species and other Proteobacteria?

While the fundamental role of ccmC in cytochrome c maturation is conserved across Proteobacteria, species-specific variations exist:

  • Complementation capacity: The ccmC gene from P. fluorescens ATCC 17400 can complement ccmC mutations in P. aeruginosa, indicating functional conservation despite potential sequence differences .

  • Regulatory integration: The degree to which ccmC function is integrated with other cellular processes appears to vary. In P. aeruginosa, ccmC has particularly profound effects on siderophore production and QS-regulated traits, which may not be identical in all species.

  • Genome context: While the core ccmABCDEFGH system is conserved, the genetic organization and potential accessory genes differ between Proteobacteria, potentially influencing ccmC function.

  • Environmental adaptation: Species adapted to different niches show variations in how ccmC mutations affect survival under stress conditions, reflecting the ecological pressures on each species.

  • Heme trafficking mechanisms: Species-specific differences in heme metabolism and trafficking pathways likely influence the precise role of ccmC in the cellular heme economy.

These variations highlight the evolutionary plasticity of the cytochrome c maturation system, suggesting that while the core biochemical function is conserved, the regulatory integration and physiological significance of ccmC have evolved to meet species-specific requirements .

What methodologies effectively quantify cytochrome c production in P. aeruginosa ccmC mutants?

Several complementary approaches provide robust quantification of cytochrome c levels:

  • Spectrophotometric analysis: Difference spectroscopy between reduced and oxidized samples allows identification of characteristic absorption peaks of c-type cytochromes (550 nm). This can be performed on whole cells or membrane fractions.

  • Heme staining: Following SDS-PAGE separation, proteins can be stained for heme-associated peroxidase activity using 3,3',5,5'-tetramethylbenzidine (TMBZ). This method provides size-specific detection of c-type cytochromes .

  • Immunoblotting: Western blotting using antibodies specific to conserved regions of c-type cytochromes or to species-specific cytochromes provides sensitive detection and quantification.

  • Mass spectrometry: Targeted proteomic approaches can identify and quantify specific cytochrome c proteins with high sensitivity and specificity.

  • Enzyme activity assays: Measuring the activity of cytochrome c-dependent enzymes (e.g., cytochrome c oxidase) provides functional assessment of the cytochrome c maturation system.

For P. aeruginosa ccmC mutants specifically, the TMBZ-based heme staining approach has proven particularly informative, demonstrating the complete absence of c-type cytochrome bands that are readily detectable in wild-type strains .

How can researchers accurately assess the iron-sulfur cluster content in ccmC mutants?

Accurate assessment of [Fe-S] cluster content requires specialized methodologies:

  • Electron paramagnetic resonance (EPR) spectroscopy: This technique detects unpaired electrons in iron-sulfur clusters, providing information about cluster type, quantity, and redox state. Different types of [Fe-S] clusters (2Fe-2S, 3Fe-4S, 4Fe-4S) exhibit characteristic EPR signals.

  • Mössbauer spectroscopy: This technique detects the nuclear resonance absorption of iron isotopes, providing detailed information about iron oxidation states and chemical environments in [Fe-S] proteins.

  • Acid-labile sulfide determination: Colorimetric assays measuring acid-labile sulfide release provide quantitative information about the total [Fe-S] cluster content in cell extracts.

  • Activity assays of [Fe-S] enzymes: Measuring the activity of enzymes known to contain [Fe-S] clusters (e.g., aconitase) provides functional assessment of [Fe-S] cluster biosynthesis and incorporation.

  • Iron quantification: Total cellular iron content, measured by atomic absorption spectroscopy or colorimetric assays, can complement direct [Fe-S] cluster measurements.

In P. aeruginosa ccmC and ccmF mutants, the reduced content of [Fe-S] clusters reveals an unexpected connection between cytochrome c maturation and iron-sulfur cluster formation, potentially linked through altered iron homeostasis or redox balance .

How can researchers address the growth limitations of ccmC mutants when conducting comparative studies?

The severe growth defects of ccmC mutants, particularly under iron limitation, present significant challenges for comparative studies. Researchers can implement several strategies:

  • Conditioned media supplementation: Prepare culture media using diluted filtrates from wild-type cultures to provide essential growth factors without introducing cells.

  • Defined medium optimization: Systematically vary medium composition (carbon sources, trace elements, buffer capacity) to identify conditions that minimize growth differences while maintaining phenotypic differences of interest.

  • Growth phase normalization: Rather than comparing cultures at the same time point, normalize comparisons to specific growth phases or cellular densities.

  • Inducible expression systems: Construct strains with inducible ccmC repression rather than constitutive knockouts, allowing controlled timing of phenotype induction after achieving sufficient biomass.

  • Co-culture experiments: Physically separate wild-type and mutant cells using membrane systems that allow medium exchange while maintaining strain separation for subsequent analysis.

  • Supplementation studies: Systematically test various supplements (heme precursors, iron sources, antioxidants) to identify those that specifically rescue growth without reverting the phenotypes under study.

These approaches help ensure that observed phenotypic differences reflect specific ccmC-related effects rather than secondary consequences of impaired growth .

What are the most common pitfalls in designing complementation experiments for ccmC mutants and how can they be avoided?

Effective complementation studies require careful consideration of several potential pitfalls:

  • Expression level imbalance: Overexpression from high-copy plasmids may cause toxicity or non-physiological effects. Solution: Use low-copy vectors and native promoters, or inducible systems titrated to match wild-type expression levels.

  • Polar effects on adjacent genes: If ccmC mutation affects expression of downstream genes, complementing with ccmC alone may be insufficient. Solution: Include the entire affected operon or confirm independent transcription of downstream genes.

  • Protein localization issues: Improperly localized CcmC cannot function correctly. Solution: Include native signal sequences and verify proper membrane localization using tagged versions or subcellular fractionation.

  • Plasmid stability: Complementation plasmids may be lost without selection. Solution: Maintain selective pressure or integrate the complementing gene into a neutral chromosomal location.

  • Heterologous expression incompatibilities: Using ccmC from different species may introduce compatibility issues. Solution: Compare complementation efficiency between homologous and heterologous genes, as demonstrated with successful P. fluorescens ccmC complementation of P. aeruginosa .

  • Conflicting selectable markers: Markers used for mutant construction may conflict with complementation vectors. Solution: Use compatible marker combinations or marker-less mutation strategies.

By addressing these considerations, researchers can ensure that complementation studies provide reliable evidence for direct linkage between ccmC function and observed phenotypes .

What innovative approaches could reveal the mechanism connecting ccmC function to catalase production and hydrogen peroxide sensitivity?

Several advanced research approaches could elucidate this intriguing connection:

  • Hydrogen peroxide flux imaging: Using genetically encoded H₂O₂ sensors to visualize real-time ROS dynamics in wild-type versus ccmC mutant cells during oxidative stress exposure.

  • Thiol proteomics: Identifying proteins undergoing oxidative modifications in ccmC mutants using mass spectrometry-based approaches to detect changes in the thiol redox proteome.

  • Heme trafficking visualization: Developing fluorescent heme analogs or tagged heme-binding proteins to track heme distribution and availability for catalase assembly in living cells.

  • Synthetic biology approaches: Creating minimal systems with defined components to reconstitute the interaction between cytochrome c maturation and catalase assembly pathways.

  • Metabolic flux analysis: Using isotope-labeled precursors to track changes in metabolic pathways that might connect cytochrome c maturation defects to catalase production.

  • Suppressor mutation screening: Identifying second-site mutations that restore catalase activity or hydrogen peroxide resistance in ccmC mutants to uncover genetic interactions.

These approaches could reveal whether the connection involves direct protein interactions, shared cofactor requirements, or indirect effects through altered cellular redox status or heme availability .

How might understanding ccmC function in P. aeruginosa contribute to developing new antimicrobial strategies?

The central role of ccmC in multiple cellular processes suggests several promising therapeutic strategies:

  • Cytochrome maturation inhibitors: Small molecules targeting CcmC function could simultaneously disrupt energy generation, iron homeostasis, and virulence factor production, creating a multifaceted antimicrobial effect.

  • Siderophore-antibiotic conjugates: The altered siderophore biology in ccmC-compromised cells could be exploited by designing siderophore-antibiotic conjugates specifically targeting cells with impaired cytochrome function.

  • Potentiators of oxidative stress: Compounds that increase oxidative stress could selectively target bacteria with ccmC inhibition, as these would be highly susceptible due to their catalase deficiency .

  • Anti-virulence approaches: Targeting CcmC could reduce virulence factor production (pyocyanin, rhamnolipids) without directly killing bacteria, potentially reducing selection pressure for resistance.

  • Iron metabolism disruptors: Combination therapies targeting both ccmC function and iron acquisition pathways could create synergistic effects due to the interconnected nature of these systems.

  • Biofilm prevention: The reduced motility and altered surface behaviors of ccmC mutants suggest that inhibiting CcmC could interfere with biofilm formation processes.

The pleiotropic effects of ccmC mutations suggest that targeting this system could simultaneously compromise multiple aspects of P. aeruginosa virulence and survival, potentially overcoming the redundancy and adaptability that make this pathogen difficult to control .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.