Recombinant Pseudomonas aeruginosa Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; PSPA7_5255; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain PA7)
Target Names
mscL
Target Protein Sequence
MGLLSEFKAFAVKGNVVDMAVGIIIGAAFGKIVSSFVGDVIMPPIGLLIGGVDFSDLAIT LKAAEGDVPAVVLAYGKFIQTILDFVIVAFAIFMGVKAINRLKREEAVAPSEPPVPSAEE TLLTEIRDLLKAQQNKP
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • How does bacterial MscL structure relate to its mechanosensing function?

    MscL contains several structural/functional themes that recur in higher organisms and help elucidate channel function. These include:

    • Direct sensing and response to biophysical changes in the membrane

    • An α helix ("slide helix") or series of charges ("knot in a rope") at the cytoplasmic membrane boundary to guide transmembrane movements

    • Important subunit interfaces that, when disrupted, cause inappropriate channel gating

    The mechanosensing mechanism involves a "lipid-moves-first" model where the number of lipid acyl chains occupying transmembrane (TM) pockets determines the conformational state of the protein. Increases in lateral tension cause movement of lipids from the pockets to the bulk bilayer, destabilizing the closed structure . This model has been supported by extensive molecular dynamics simulations and spectroscopic studies.

  • What are the current methods for recombinant expression of Pseudomonas aeruginosa MscL?

    Recombinant Pseudomonas aeruginosa MscL can be successfully expressed in Escherichia coli expression systems. Based on available research data, the following methodology has proven effective:

    • Expression vector: pUCP20 or similar E. coli-Pseudomonas shuttle vectors with appropriate antibiotic resistance markers

    • Protein fusion: N-terminal His-tag for purification purposes

    • Expression conditions: Growth until OD600 of 0.8, induction with 0.1 mM IPTG for 4 hours at 25°C

    • Medium composition: 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, 1 g/L glucose with appropriate antibiotic (e.g., 30 μg/mL kanamycin)

    • Storage: After purification, the protein can be stored in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    For long-term storage, addition of 5-50% glycerol and storage at -20°C/-80°C is recommended, with 50% glycerol being the default concentration for optimal stability .

Advanced Research Questions

  • What experimental approaches are most effective for assessing MscL gating mechanisms?

    Multiple complementary techniques have proven effective for studying MscL gating mechanisms:

    • Patch-clamp electrophysiology: Measures channel conductance under applied tension, providing functional analysis of channel opening and closing

    • Cysteine scanning mutagenesis: Systematic replacement of residues with cysteine to identify functional regions, coupled with sulfhydryl modification to modulate channel function

    • Spectroscopic techniques:

      • Continuous wave electron paramagnetic resonance (cwEPR): Detects local conformational changes

      • Pulsed electron-electron double resonance (PELDOR/DEER): Provides high-resolution distance measurements between specific sites

      • Electron spin echo envelope modulation (ESEEM): Measures water accessibility changes during gating

      • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies structural transitions

    • Molecular dynamics (MD) simulations: Models channel behavior under tension, allowing visualization of pore hydration and lipid interactions

    • Cell viability/growth assays: Assesses channel function in vivo, particularly when modulated by mutations or small molecules

  • How do specific mutations affect MscL function and what applications can these enable?

    Several key mutations have been identified that significantly alter MscL function:

    • L89W mutation in TbMscL (corresponding to M94 in E. coli): Stabilizes an expanded and subconducting state by hindering lipid acyl chain penetration into transmembrane pockets. This reduces the threshold required for channel conductance

    • G22C mutation in EcMscL pore: When coupled with sulfhydryl-reactive modulators, creates a pH-sensitive channel that can be triggered by pH changes

    • Cysteine mutations with photo-switchable attachments: Allows light-controlled gating of the channel

    These engineered channels have potential applications in:

    • Controlled drug delivery systems

    • Biosensors for mechanical or chemical stimuli

    • Synthetic biology circuitry requiring mechanical inputs

    • Model systems for studying mechanosensation

  • What techniques are most reliable for studying conformational changes of MscL during gating?

    The most informative techniques for studying MscL conformational changes include:

    • Pulsed EPR techniques (PELDOR/DEER): Provides distance measurements between spin-labeled residues with angstrom resolution, enabling detection of protein movements during gating. This technique has successfully characterized the expanded state of TbMscL with the L89W mutation

    • ESEEM spectroscopy: Measures water accessibility changes in specific regions of the protein during gating, providing information about pore hydration

    • HDX-MS experiments: Identifies regions with altered solvent accessibility during conformational changes, highlighting structural transitions that occur during channel modulation

    • MD simulations: Provide atomic-level visualization of protein movements, lipid interactions, and water penetration during channel gating

    These techniques have been instrumental in validating the "lipid-moves-first" model of mechanosensation in MscL and characterizing intermediates in the gating pathway.

  • How does the lipid environment influence MscL function and what methodologies best elucidate these interactions?

    The lipid environment critically influences MscL function through multiple mechanisms:

    • Membrane thickness: Affects the energetics of channel opening, with thinner membranes facilitating channel activation

    • Lipid-protein interactions: Specific lipid-protein interactions in transmembrane pockets influence channel stability and gating threshold

    • Lateral pressure profile: Changes in membrane tension alter the lateral pressure profile, which directly affects channel conformation

    Methodologies for studying these interactions include:

    • cwEPR spectroscopy: Detects lipid interactions with specific protein regions, supporting the "dragging" model where lipids interact with the N-terminus during channel expansion

    • MD simulations: Model lipid-protein interactions at atomic resolution, showing how tension affects lipid distribution around the channel

    • Site-directed mutagenesis: Targeted mutations at lipid-interacting residues can disrupt specific lipid-protein interactions and alter channel function

    • Reconstitution in lipid nanodiscs: Allows control of lipid composition for functional and structural studies

  • What is known about MscL as a potential target for novel antimicrobial compounds?

    MscL has emerging potential as a target for novel antimicrobials based on several key findings:

    • Channel agonists: Compounds such as 011A have been found to affect growth and viability of multiple bacterial species including Staphylococcus aureus and Mycobacterium smegmatis in a MscL-dependent manner

    • Antibiotic potentiation: MscL activators can increase the potency of conventional antibiotics (dihydrostreptomycin, kanamycin, tetracycline, and ampicillin) by permeabilizing the membrane and facilitating antibiotic entry into the cytoplasm

    • Structurally diverse binding site: Despite structural diversity, all currently known MscL agonists (including dihydrostreptomycin, Ramizol, 011A, K05, and compound 262) bind to a similar region near the transmembrane pocket

    • Conservation across species: The high conservation of MscL across bacterial species suggests that MscL-targeting compounds could function as broad-spectrum antibiotics or adjuvants

    The binding pocket for these compounds is located at the cytoplasmic-membrane interface, with residue 97 in E. coli MscL identified as essential for binding .

  • How can MscL function be assessed in heterologous expression systems?

    Several approaches have been validated for assessing MscL function in heterologous systems:

    • Patch-clamp recordings: Application of calibrated suction pressures can directly measure channel opening in response to membrane tension

    • Growth phenotype assays: Expression of functional MscL can affect bacterial growth rates, particularly under osmotic stress conditions

    • Cell viability assays: Activation of MscL by compounds or mutations can decrease viability of quiescent cultures, providing a functional readout

    • Antibiotic sensitivity tests: Functional MscL expression can alter antibiotic sensitivity profiles, particularly when combined with MscL-activating compounds

    • Fluorescence-based assays: Monitoring release of fluorescent molecules from cells or liposomes containing MscL can provide a quantitative measure of channel activity

    For neuronal systems specifically, functional expression of engineered MscL has been validated through patch-clamp recordings and by verifying network development in terms of cell survival, number of synaptic puncta, and spontaneous network activity .

  • What is the role of MscL in antimicrobial resistance and how can this be experimentally investigated?

    MscL influences antimicrobial resistance through several mechanisms:

    • Antibiotic entry pathway: The antibiotic dihydrostreptomycin (DHS) crosses the membrane primarily through MscL

    • Membrane permeabilization: MscL activation increases membrane permeability, potentially allowing increased influx of antibiotics

    • Synergistic effects: MscL activators can increase the potency of conventional antibiotics, suggesting a role in overcoming certain resistance mechanisms

    Experimental approaches to investigate these relationships include:

    • Minimum inhibitory concentration (MIC) assays: Comparing MIC values with and without MscL activators across different bacterial strains and mutants

    • MscL knockout studies: Comparing antibiotic sensitivity in wild-type and MscL-deficient strains

    • Combination therapy testing: Evaluating synergistic effects between MscL activators and conventional antibiotics against resistant bacterial strains

    • Radiolabeled antibiotic uptake assays: Measuring antibiotic influx rates in the presence and absence of MscL activators

  • What are the challenges and solutions for purifying functional recombinant Pseudomonas aeruginosa MscL?

    Purification of functional MscL presents several challenges due to its membrane protein nature:

    • Expression levels: Membrane proteins often express at lower levels than soluble proteins

    • Protein folding: Ensuring proper membrane insertion and folding is critical for function

    • Detergent selection: Finding detergents that extract MscL while maintaining its native structure

    • Stability: Maintaining stability during purification and storage

    Effective solutions based on available data include:

    • His-tag purification: N-terminal His-tagging allows efficient purification via nickel affinity chromatography

    • Optimized expression conditions: Using lower temperatures (25°C) and moderate induction (0.1 mM IPTG) can improve proper folding

    • Buffer optimization: Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has proven effective for storage

    • Reconstitution approach: For functional studies, reconstitution into lipid nanodiscs can maintain native-like lipid environment

    • Cryoprotection: Addition of 50% glycerol for long-term storage at -20°C/-80°C protects protein integrity

  • How can MscL be developed as a tool for targeted drug delivery or biosensing applications?

    MscL has significant potential for biotechnological applications:

    • Triggered nanovalve: The modality of the MscL channel can be changed, suggesting its use as a triggered nanovalve in nanodevices for drug targeting

    • Mechano-sensitization: Engineered MscL can be used to mechano-sensitize mammalian neuronal networks, providing a cell-type-specific stimulation approach

    • Chemical triggers: Engineering MscL to respond to specific chemical triggers (pH, light) through cysteine modification enables controlled gating

    Development strategies include:

    • Site-directed mutagenesis: Introduction of specific mutations (like G22C) that can be coupled with chemical modifiers to create channels responsive to specific stimuli

    • Reconstitution in liposomes: Incorporation of engineered MscL into liposomes for drug delivery applications

    • Cell-specific expression: Expressing engineered MscL in specific cell types for targeted intervention

    • Optimization of gating properties: Tuning the threshold and kinetics of channel opening through mutations and chemical modifications to match specific application requirements

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.