Recombinant Pseudomonas aeruginosa Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

MsbA (membrane-bound ATPase) is a critical ATP-binding cassette (ABC) transporter in Pseudomonas aeruginosa, a Gram-negative bacterium associated with severe hospital-acquired infections . It functions as a homodimer, translocating lipid A-core (a precursor of lipopolysaccharide, LPS) from the cytoplasmic to the periplasmic leaflet of the inner membrane . LPS is essential for outer membrane stability and pathogenicity, making MsbA indispensable for bacterial viability .

Key FeaturesDetails
Gene EssentialityDisruption is lethal without a functional copy; cannot be complemented by E. coli MsbA .
Substrate SpecificityTransports lipid A-core and truncated LPS precursors; phosphate substituents enhance ATPase activity .
Antibiotic ResistanceEffluxes nitroimidazole antibiotics via an outward-facing conformation .

2.2. ATPase Activity and Zinc Dependence

  • ATPase Kinetics:

    • Stimulators: Zn²⁺ (unlike Mg²⁺ in E. coli) and lipid A-core .

    • Inhibitors: Vanadate trapping requires Zn²⁺, indicating a unique metal-dependent mechanism .

  • Triad of Histidines: Residues H⁴³⁸, H⁴⁴², and H⁴⁴⁶ form a Zn²⁺-binding site, critical for NBD dimerization and ATP hydrolysis .

ParameterPaMsbAEcMsbA
Metal CofactorZn²⁺ (required for vanadate trapping)Mg²⁺ (no Zn²⁺ dependence)
ATPase RateStimulated by Zn²⁺ and lipid A-coreBasal activity with Mg²⁺
Structural FlexibilityAsymmetric NBD positioning in TBT1-bound stateSymmetric NBD dimerization

Mechanism of Lipid A-Core Transport

MsbA employs an alternating-access mechanism to flip lipid A-core across the membrane:

  1. Substrate Binding: Lipid A-core interacts with hydrophobic pockets in TMDs .

  2. ATP Binding: NBDs dimerize, driving a conformational shift to the outward-facing state .

  3. ATP Hydrolysis: Energy release facilitates substrate release to the periplasm .

3.1. Species-Specific Adaptations

  • Phosphate Dependency: PaMsbA requires phosphate groups in lipid A-core for maximal ATPase activity, unlike E. coli .

  • Drug Resistance: Overexpression confers resistance to erythromycin, but E. coli MsbA cannot replicate this in P. aeruginosa .

Role in Antibiotic Resistance and Drug Targeting

MsbA contributes to multidrug resistance (MDR) by effluxing:

  • Nitroimidazole Antibiotics (e.g., metronidazole) .

  • Amphipathic Compounds: Alters protein conformation, reducing inhibitor binding .

  • Occluded State: Zn²⁺-bound PaMsbA shows a closed TMD portal, trapping lipid A-core .

  • Outward-Facing State: Resolved at 2.72 Å, revealing a wide transmembrane cavity for substrate passage .

5.2. Zinc-Dependent Dimerization

  • Functional Triad: H⁴³⁸, H⁴⁴², H⁴⁴⁶ coordinate Zn²⁺, enabling NBD dimerization .

  • Mutational Impact: H⁴³⁸A/H⁴⁴²A/H⁴⁴⁶A abolishes Zn²⁺ stimulation, confirming metal dependency .

Production and Applications

Recombinant PaMsbA is expressed in E. coli with an N-terminal His-tag for purification . Key steps include:

  1. Cloning: Codon-optimized gene synthesis (e.g., Twist Bioscience) .

  2. Purification: Ni-NTA chromatography in detergent (e.g., dodecyl maltoside) .

  3. Reconstitution: Proteoliposomes for functional assays (e.g., ATPase activity) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. To ensure preferential development of a specific tag, please specify your requirements.
Synonyms
msbA; PA4997; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-603
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
msbA
Target Protein Sequence
MSDSPQNPGPSSLKIYFRLLGYVKPYIGMFLLSIVGFLIFASTQPMLAGILKYFVDGLSN PDAALFPNVQWPWLRDLHLVYAVPLLIILIAAWQGLGSFLGNFFLAKVSLGLVHDLRVAL FNKLLVLPNRYFDTHSSGHLISRITFNVTMVTGAATDAIKVVIREGLTVVFLFLYLLWMN WKLTLVMLAILPVIAVMVTTASRKFRKQSKKIQVAMGDVTHVASETIQGYRVVRSFGGEA YEEKRFLDASQSNTDKQLRMTKTGAVYTPMLQLVIYVAMAILMFLVLWLRGDASAGDLVA YITAAGLLPKPIRQLSEVSSTVQRGVAGAESIFEQLDEAAEEDQGTVEKERVSGRLEVRN LSFRYPGTDKQVLDDISFIAEPGQMIALVGRSGSGKSTLANLVPRFYQHNDGKILLDGVE VEDYRLRNLRRHIALVTQQVTLFNDSVANNIAYGDLAGAPREEIERAAKAANAKEFIDNL PQGFDTEVGENGVLLSGGQRQRLAIARALLKDAPLLILDEATSALDTESERHIQAALDEV MKGRTTLVIAHRLSTIEKADLILVMDQGQIVERGSHAELLAQNGHYARLHAMGLDEQAPA PVG
Uniprot No.

Target Background

Function

MsbA is involved in lipopolysaccharide (LPS) biosynthesis. It translocates lipid A-core from the inner to the outer leaflet of the inner membrane. The protein's transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) provides the energy for this process.

Database Links

KEGG: pae:PA4997

STRING: 208964.PA4997

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of MsbA in Pseudomonas aeruginosa?

MsbA in Pseudomonas aeruginosa functions as an essential ATP-binding cassette (ABC) transporter that translocates lipid A and lipopolysaccharide (LPS) from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane. This translocation is a critical step in the biogenesis of the bacterial outer membrane. The protein is encoded by the msbA gene (PA4997) in the P. aeruginosa genome and belongs to the ABC transporter family, playing a vital role in membrane assembly and maintenance .

The translocation mechanism follows a "trap and flip" model, whereby lipid A is captured from its site of synthesis and flipped across the membrane through conformational changes in the transporter. This process is essential for bacterial survival, as evidenced by the lethality of msbA gene mutations .

How does the structure of P. aeruginosa MsbA differ from MsbA in other bacterial species?

P. aeruginosa MsbA (PaMsbA) exhibits distinctive structural features compared to its homologs in other bacteria, particularly Escherichia coli MsbA (EcMsbA). While both proteins share the fundamental ABC transporter architecture, they differ in several key aspects:

  • PaMsbA contains a unique triad of histidine residues that are critical for its function and are not present in EcMsbA .

  • The transmembrane domains of PaMsbA show specific adaptations for interaction with P. aeruginosa lipid A, which has a different structure compared to E. coli lipid A .

  • The nucleotide-binding domains display variations that contribute to differences in ATPase activity kinetics between the two proteins .

These structural differences explain why msbA from E. coli cannot functionally complement msbA-deficient P. aeruginosa, highlighting the species-specific adaptations of these transporters .

Why is MsbA considered an essential protein in P. aeruginosa?

MsbA is essential in P. aeruginosa because:

  • Genetic studies demonstrate that mutations in the msbA gene are lethal to the bacterium, indicating its indispensable role in cellular function .

  • Disruption of the chromosomal msbA can only be achieved when a functional copy of the gene is provided in trans, confirming its essential nature .

  • MsbA facilitates the translocation of lipid A and LPS, which are major constituents of the outer membrane essential for bacterial viability and integrity .

  • The transport function of MsbA represents a critical step in the biogenesis pathway of the outer membrane, without which the bacterium cannot maintain its envelope integrity or resist environmental stresses .

The essentiality of MsbA also makes it an attractive target for the development of novel antibiotics against P. aeruginosa, a significant pathogen associated with hospital-acquired infections .

What are the most effective methods for expressing and purifying recombinant P. aeruginosa MsbA?

Effective expression and purification of recombinant PaMsbA can be achieved through the following methodological approach:

  • Expression construct preparation:

    • Clone the codon-optimized PaMsbA gene (UniProt Q9HUG8) into a modified pCDF-1b plasmid .

    • Include an N-terminal His6 fusion tag with a TEV protease cleavage site for purification purposes .

    • Verify the construct through DNA sequencing before proceeding with expression .

  • Expression conditions:

    • Transform the expression construct into E. coli expression strains such as BL21(DE3) or C43(DE3).

    • Culture cells in appropriate media (LB or TB) at 37°C until reaching optimal density.

    • Induce protein expression with IPTG at reduced temperature (16-18°C) to enhance proper folding.

  • Membrane preparation and solubilization:

    • Harvest cells and disrupt via French press or sonication in buffer containing protease inhibitors.

    • Isolate membranes through differential ultracentrifugation.

    • Solubilize the membrane fraction using appropriate detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG).

  • Purification steps:

    • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin.

    • Optionally, cleave the His6-tag with TEV protease.

    • Further purify through size exclusion chromatography to obtain homogeneous protein.

This approach has been successfully employed in recent structural studies of PaMsbA, yielding protein suitable for various biochemical and structural analyses .

What structural biology techniques are most informative for studying conformational states of MsbA?

Multiple complementary structural biology techniques provide valuable insights into the conformational states of MsbA:

The most informative approach involves combining these techniques. For example, using SANS with deuterium-labeled "stealth carrier" nanodiscs allows researchers to study MsbA in a native-like lipid environment while rendering the nanodiscs effectively invisible to neutron diffraction . This approach has successfully detected differences between conformational states of MsbA, demonstrating its sensitivity and applicability to membrane protein studies .

How can researchers effectively measure the ATPase activity of recombinant PaMsbA?

Effective measurement of PaMsbA ATPase activity requires careful consideration of assay conditions and activators:

  • Basic assay methodology:

    • Use a coupled enzyme assay (with pyruvate kinase and lactate dehydrogenase) to monitor ATP hydrolysis through NADH oxidation spectrophotometrically.

    • Alternatively, employ a malachite green assay to quantify released inorganic phosphate.

    • Maintain appropriate temperature (typically 37°C) and pH (7.4-8.0) for optimal activity.

  • Critical considerations specific to PaMsbA:

    • Include Zn²⁺ rather than Mg²⁺ as the divalent cation cofactor, as PaMsbA activity is specifically stimulated by Zn²⁺ .

    • When using ATP-trapping approaches (such as vanadate trapping), remember that successful trapping of PaMsbA requires Zn²⁺, unlike EcMsbA which requires Mg²⁺ .

    • Ensure the protein is in an appropriate detergent or lipid environment that maintains native conformation and activity.

  • Substrate stimulation:

    • Test various lipid A and core OS structures to identify optimal substrates.

    • Pay particular attention to phosphate substituents in the lipid A-core, as these are important for stimulating ATPase activity .

    • Include truncated versions of core OS of P. aeruginosa LPS in assays to observe selective stimulation effects .

  • Controls and validation:

    • Include ATPase-deficient mutants (e.g., Walker A or B mutants) as negative controls.

    • Use known inhibitors to validate assay specificity.

    • Test histidine mutants, particularly those in the histidine triad identified as important for Zn²⁺ stimulation, to confirm mechanism .

These methodological considerations ensure accurate measurement of PaMsbA activity and highlight the unique biochemical properties that distinguish it from other MsbA homologs.

How does the mechanism of lipid A transport differ between P. aeruginosa MsbA and E. coli MsbA?

The mechanism of lipid A transport differs significantly between PaMsbA and EcMsbA in several important aspects:

  • Metal ion dependency:

    • PaMsbA ATPase activity is specifically stimulated by Zn²⁺, whereas EcMsbA requires Mg²⁺ .

    • Successful trapping of PaMsbA with vanadate requires Zn²⁺, not Mg²⁺, which is necessary for EcMsbA .

    • This difference is linked to a unique triad of histidine residues in PaMsbA that mediates Zn²⁺ stimulation .

  • Substrate specificity:

    • PaMsbA shows distinct preferences for P. aeruginosa lipid A structures, particularly recognizing specific phosphate substituents in the lipid A-core .

    • The ATPase activity of PaMsbA is selectively stimulated by different truncated versions of core OS of P. aeruginosa LPS .

    • These preferences reflect adaptations to the unique structure of P. aeruginosa lipid A compared to E. coli lipid A.

  • Functional complementation:

    • msbA from E. coli cannot cross-complement msbA merodiploid cells of P. aeruginosa, indicating mechanistic incompatibilities .

    • Interestingly, expression of EcMsbA, but not PaMsbA, confers resistance to erythromycin in P. aeruginosa, suggesting different substrate specificities or transport mechanisms .

  • Kinetic properties:

    • The kinetics of ATPase activity for PaMsbA are "vastly different" from those of EcMsbA, as directly stated in the literature .

    • These differences may reflect adaptations to the specific outer membrane composition and environmental challenges faced by each bacterial species.

What role does the histidine triad play in PaMsbA function and how might it be targeted in research studies?

The histidine triad in PaMsbA plays a crucial role in its function and represents an important target for research studies:

  • Structural and functional significance:

    • Cryogenic-electron microscopy structures reveal a triad of histidine residues specific to PaMsbA .

    • This triad mediates the stimulation of PaMsbA ATPase activity by Zn²⁺ rather than Mg²⁺ .

    • Mutation of these histidine residues abolishes Zn²⁺ stimulation of PaMsbA activity, confirming their mechanistic importance .

  • Research strategies to target the histidine triad:

    • Site-directed mutagenesis: Systematically mutate individual histidine residues or combinations to assess their relative contributions to Zn²⁺ binding and activity stimulation.

    • Metal ion binding studies: Use isothermal titration calorimetry or fluorescence-based assays to characterize Zn²⁺ binding to wild-type and mutant PaMsbA.

    • Structural studies: Compare conformational changes induced by Zn²⁺ versus Mg²⁺ binding using techniques like cryo-EM or SAXS/SANS.

    • Molecular dynamics simulations: Model the effects of histidine mutations on protein dynamics and metal ion coordination.

  • Potential as a drug target:

    • The unique histidine triad represents a species-specific feature that could be exploited for selective inhibition of PaMsbA.

    • Design of small molecules that interfere with Zn²⁺ binding to the histidine triad could provide selective inhibitors of PaMsbA.

    • Zinc-chelating compounds could be screened for their ability to inhibit PaMsbA activity through disruption of this mechanism.

  • Evolutionary significance:

    • Comparative genomic analysis could explore the presence of similar histidine triads in MsbA proteins from other Pseudomonas species or related bacteria.

    • Understanding the evolutionary origin of this feature may provide insights into bacterial adaptation to different environmental niches.

This unique metal ion dependency mechanism represents both an important research target for understanding PaMsbA function and a potential opportunity for developing selective inhibitors against P. aeruginosa.

How does the lipid environment affect the conformational dynamics and transport activity of PaMsbA?

The lipid environment significantly impacts PaMsbA conformational dynamics and transport activity through multiple mechanisms:

  • Lipid-protein interactions affecting structure:

    • Native mass spectrometry studies have determined specific lipid binding affinities of PaMsbA in different conformations, indicating that lipid binding is conformation-dependent .

    • X-ray crystallography has identified putative lipid A binding sites within the transmembrane cavity, consistent with a "trap and flip" transport model .

    • Additional lipid A binding sites have been observed near an outer surface cleft at the periplasmic ends of the transmembrane helices, suggesting a potential exit pathway .

  • Methodological approaches to study lipid effects:

    • "Stealth carrier" nanodiscs with fractional deuterium labeling provide an excellent system for studying PaMsbA in a native-like lipid environment using neutron scattering techniques .

    • These nanodiscs become effectively invisible to low-resolution neutron diffraction, enabling direct observation of the protein signal without contribution from the surrounding lipid environment .

    • This approach has successfully detected differences between conformational states of MsbA, demonstrating its sensitivity for studying membrane protein conformational changes .

  • Specific lipid components affecting activity:

    • Phosphate substituents in the lipid A-core are particularly important for stimulating the ATPase activity of PaMsbA .

    • Different truncated versions of core OS of P. aeruginosa LPS selectively stimulate PaMsbA activity, indicating specific recognition of lipid structures .

    • These structural requirements likely reflect adaptations to the unique composition of P. aeruginosa membranes.

  • Experimental considerations for reconstitution:

    • When studying PaMsbA activity in reconstituted systems, researchers should carefully consider lipid composition to mimic the native P. aeruginosa membrane environment.

    • Parameters such as membrane thickness, fluidity, and charge distribution all potentially impact transporter conformational dynamics.

    • The presence of specific phospholipids and lipopolysaccharide components may be necessary to observe physiologically relevant activity levels.

Understanding these lipid-protein interactions is essential for accurate characterization of PaMsbA function and for the development of effective inhibitors targeting this essential transporter.

What evolutionary insights can be gained from comparing MsbA sequences across different Pseudomonas species?

Comparative analysis of MsbA sequences across Pseudomonas species provides valuable evolutionary insights:

  • Conservation of essential functional domains:

    • The Walker A and B motifs in the nucleotide-binding domains are highly conserved across species, reflecting their critical role in ATP binding and hydrolysis.

    • Transmembrane domains show greater sequence variation, likely reflecting adaptations to species-specific lipid A structures.

    • The unique histidine triad identified in P. aeruginosa MsbA may show varying degrees of conservation across Pseudomonas species, potentially correlating with differences in metal ion requirements.

  • Correlation with lipid A structural diversity:

    • Sequence variations in MsbA transporters often correlate with structural differences in lipid A between Pseudomonas species.

    • These correlations can help identify regions of the transporter involved in substrate recognition and specificity.

    • Mapping sequence conservation onto structural models can highlight species-specific adaptations in substrate binding sites.

  • Methodological approach for comparative analysis:

    • Perform multiple sequence alignment of MsbA proteins from various Pseudomonas species.

    • Calculate conservation scores for each residue and map them onto available structural models.

    • Use phylogenetic analysis to reconstruct the evolutionary history of MsbA within the Pseudomonas genus.

    • Correlate MsbA sequence clusters with lipid A structural variations across species.

  • Implications for inhibitor development:

    • Identification of regions that are conserved specifically within pathogenic Pseudomonas species but differ from commensal bacteria.

    • Design of selective inhibitors targeting these Pseudomonas-specific features.

    • Prediction of potential resistance mechanisms based on natural sequence variations.

This evolutionary perspective not only enhances our understanding of MsbA function but also guides the development of targeted therapeutic approaches against Pseudomonas infections.

How can researchers effectively design experiments to investigate the structural basis of substrate specificity in PaMsbA?

Effective experimental design for investigating PaMsbA substrate specificity should incorporate multiple complementary approaches:

  • Structure-guided mutagenesis:

    • Identify residues lining the transmembrane cavity and substrate binding sites based on available structural data .

    • Create a systematic panel of point mutations targeting these residues.

    • Assess the effects of mutations on lipid A binding affinity and transport activity.

    • Particularly focus on residues that differ between PaMsbA and EcMsbA to understand species-specific substrate preferences.

  • Chimeric protein construction:

    • Design chimeric proteins with domains swapped between PaMsbA and EcMsbA.

    • Test the ability of these chimeras to transport different lipid A structures.

    • Determine which regions confer specificity for P. aeruginosa versus E. coli lipid A.

    • Assess whether chimeras can complement msbA-deficient strains of either species.

  • Binding assays with modified substrates:

    • Use native mass spectrometry to determine binding affinities of PaMsbA for various lipid A structures .

    • Systematically modify lipid A structures to identify essential features for recognition.

    • Pay particular attention to phosphate substituents, which have been shown to be important for stimulating ATPase activity .

    • Compare binding affinities across different conformational states of the transporter.

  • Structural studies of substrate-bound complexes:

    • Attempt co-crystallization or cryo-EM studies of PaMsbA with bound lipid A.

    • Use cross-linking approaches to stabilize transient substrate-bound states.

    • Employ molecular dynamics simulations to model substrate binding and predict key interaction sites.

    • Validate computational predictions through experimental approaches like hydrogen-deuterium exchange mass spectrometry.

  • Functional complementation studies:

    • Test whether mutant or chimeric MsbA proteins can functionally complement msbA-deficient P. aeruginosa.

    • Assess whether modifications to EcMsbA can enable it to function in P. aeruginosa.

    • Correlate complementation ability with biochemical measures of substrate specificity.

These methodological approaches, used in combination, would provide comprehensive insights into the structural basis of PaMsbA substrate specificity.

What are the major challenges in obtaining high-resolution structural information for PaMsbA and how can they be overcome?

Obtaining high-resolution structural information for PaMsbA presents several significant challenges that can be addressed through innovative approaches:

  • Membrane protein instability:

    • Challenge: Membrane proteins like PaMsbA are often unstable when extracted from their native lipid environment.

    • Solution: Use of facial amphiphiles or novel detergents specifically designed for membrane protein stabilization . These compounds maintain the protein in a native-like environment while allowing for structural studies.

  • Conformational heterogeneity:

    • Challenge: ABC transporters like MsbA exist in multiple conformational states, making it difficult to capture a single state for high-resolution studies.

    • Solution: Employ conformational trapping strategies using nucleotide analogs, vanadate, or specific mutations that lock the protein in defined states . Remember that PaMsbA requires Zn²⁺ rather than Mg²⁺ for successful vanadate trapping .

  • Crystallization difficulties:

    • Challenge: Membrane proteins are notoriously difficult to crystallize due to their hydrophobic surfaces and limited polar contacts.

    • Solution: Use of lipidic cubic phase crystallization methods, antibody fragments or nanobodies as crystallization chaperones, and fusion proteins to increase polar surface area.

  • Sample heterogeneity:

    • Challenge: Recombinant membrane protein preparations often contain aggregates or multiple oligomeric states.

    • Solution: Rigorous quality control through analytical ultracentrifugation, size exclusion chromatography coupled with multi-angle light scattering, and negative-stain electron microscopy to ensure sample homogeneity before structural studies.

  • Low expression yields:

    • Challenge: Membrane proteins typically express at lower levels than soluble proteins.

    • Solution: Optimization of expression systems, including use of specialized E. coli strains, codon optimization, and expression tags designed specifically for membrane proteins. Consider baculovirus expression systems for higher yields.

  • Complementary approaches:

    • Combine multiple structural techniques including X-ray crystallography, cryo-EM, SAXS/SANS, and native mass spectrometry to obtain a comprehensive structural understanding .

    • Use "stealth carrier" nanodiscs with fractional deuterium labeling for neutron scattering studies, enabling visualization of the protein without interference from the lipid environment .

Recent successes in determining PaMsbA structures at resolutions of 2.72-2.98 Å demonstrate that these challenges can be overcome through careful methodological approaches .

How can researchers effectively study the in vivo function of PaMsbA given that it is an essential gene?

Studying the in vivo function of essential genes like msbA presents unique challenges that require creative experimental approaches:

  • Conditional expression systems:

    • Implement tightly regulated inducible promoters (e.g., tetracycline-responsive) to control msbA expression.

    • Create strains where the chromosomal copy is deleted and the gene is supplied on a plasmid under inducible control.

    • Gradually decrease expression by removing the inducer to observe phenotypic effects before lethality.

  • Merodiploid complementation:

    • Utilize the approach mentioned in the search results where disruption of the chromosomal msbA was achieved only when a functional copy was provided in trans .

    • This strategy allows testing of mutated versions of msbA while maintaining cell viability through the functional copy.

    • After establishing the merodiploid strain, introduce mutations in the chromosomal copy to study their effects.

  • Dominant negative approaches:

    • Express mutant versions of PaMsbA (e.g., ATPase-deficient mutants) in wild-type cells.

    • These mutants can interfere with normal MsbA function through oligomerization with wild-type subunits.

    • Titrate expression levels to achieve partial inhibition without causing complete lethality.

  • Chemical genetics:

    • Identify small molecule inhibitors of PaMsbA that allow for dose-dependent and reversible inhibition.

    • Use these compounds to temporarily reduce PaMsbA function for phenotypic studies.

    • Time-course studies can reveal the immediate effects of PaMsbA inhibition before secondary effects or lethality occur.

  • CRISPR interference (CRISPRi):

    • Employ catalytically dead Cas9 (dCas9) with guide RNAs targeting the msbA promoter.

    • This approach allows for tunable repression of gene expression without genome editing.

    • Titrate the level of repression to achieve partial knockdown for phenotypic studies.

  • Functional complementation assays:

    • Test the ability of MsbA homologs or mutants to complement msbA deficiency.

    • The search results indicate that EcMsbA cannot complement PaMsbA function, highlighting species-specific requirements .

    • This approach can identify essential functional domains and residues.

These methodological strategies enable researchers to study the in vivo function of essential genes like msbA while circumventing the challenge of lethality associated with complete gene deletion.

What are the most promising approaches for developing inhibitors targeting PaMsbA for antimicrobial applications?

Development of PaMsbA inhibitors represents a promising antimicrobial strategy, with several targeted approaches:

  • Structure-based drug design:

    • Utilize high-resolution structural data of PaMsbA (2.72-2.98 Å) to identify potential binding pockets .

    • Focus on regions that differ from human ABC transporters to ensure selectivity.

    • Apply computational screening of compound libraries against these binding sites.

    • Prioritize compounds that interact with conserved residues critical for transporter function.

  • Targeting the unique Zn²⁺-dependent mechanism:

    • Design inhibitors that specifically interfere with the histidine triad responsible for Zn²⁺ stimulation of PaMsbA .

    • Develop zinc-chelating compounds that selectively disrupt this interaction.

    • This approach exploits the species-specific metal ion dependency of PaMsbA, potentially providing selective inhibitors.

  • Substrate competitive inhibitors:

    • Design lipid A analogs that bind to the substrate binding site but cannot be transported.

    • Focus on mimicking the phosphate substituents in lipid A-core that are important for interaction with PaMsbA .

    • These compounds would compete with natural substrates but remain bound to the transporter.

  • ATP-competitive inhibitors:

    • Develop nucleotide analogs that bind to the ATP-binding sites but do not support the conformational changes required for transport.

    • Target specific residues in the nucleotide-binding domains that differ between bacterial and human ABC transporters.

  • Allosteric inhibitors:

    • Identify allosteric sites that, when occupied, prevent the conformational changes required for transport.

    • The "stealth nanodisc" approach with SANS/SAXS could be valuable for screening compounds that lock PaMsbA in specific conformations .

  • High-throughput screening methodology:

    • Develop assays based on PaMsbA ATPase activity for primary screening.

    • Remember to use Zn²⁺ rather than Mg²⁺ as the divalent cation to ensure physiologically relevant activity .

    • Implement secondary screening using transport assays in proteoliposomes or bacterial growth inhibition tests.

  • Combination approaches:

    • Identify compounds that synergize with existing antibiotics by partially inhibiting PaMsbA.

    • The observation that EcMsbA expression confers erythromycin resistance in P. aeruginosa suggests potential interactions between MsbA function and antibiotic susceptibility .

These approaches leverage the unique structural and functional characteristics of PaMsbA to develop selective inhibitors with potential application against P. aeruginosa infections.

How might new technological advances in structural biology impact our understanding of PaMsbA transport mechanism?

Emerging technological advances in structural biology are poised to significantly enhance our understanding of the PaMsbA transport mechanism:

  • Time-resolved cryo-EM:

    • This technique captures structural snapshots of proteins during dynamic processes.

    • Applied to PaMsbA, it could reveal transient conformational states during the transport cycle that have been inaccessible to traditional structural methods.

    • Mixing lipid A substrates with PaMsbA just before vitrification could capture various stages of substrate binding and translocation.

  • Cryo-electron tomography (cryo-ET):

    • Enables visualization of membrane proteins in their native cellular environment.

    • Could provide insights into the organization and dynamics of PaMsbA within the bacterial inner membrane.

    • May reveal interactions with other membrane components that influence transporter function.

  • Single-particle combinatorial FRET imaging:

    • Monitors real-time conformational changes in individual membrane protein molecules.

    • Strategic placement of fluorophores at key positions in PaMsbA would allow direct observation of the conformational dynamics during transport.

    • Could determine the sequence and kinetics of conformational changes triggered by substrate binding and ATP hydrolysis.

  • Mass photometry:

    • Enables label-free detection of biomolecular interactions at the single-molecule level.

    • Could provide new insights into the oligomeric state of PaMsbA and its interactions with lipid substrates.

    • May reveal previously undetected transient interactions with other membrane components.

  • Integrative structural biology approaches:

    • Combining multiple techniques (X-ray crystallography, cryo-EM, SAXS/SANS, mass spectrometry, and molecular dynamics simulations) provides complementary information .

    • The "stealth nanodisc" approach with neutron scattering could be particularly valuable for studying PaMsbA in a native-like lipid environment .

    • Cross-validation across multiple methods increases confidence in structural models and mechanistic interpretations.

  • AlphaFold and machine learning applications:

    • AI-based structure prediction could help model conformational states that have resisted experimental determination.

    • Deep learning approaches could identify patterns in structural data that reveal new mechanistic insights.

    • These computational approaches complement experimental methods and guide hypothesis generation.

These technological advances are expected to provide unprecedented insights into the dynamic conformational changes of PaMsbA during the transport cycle, the molecular basis of substrate specificity, and the mechanisms of inhibition, ultimately informing the development of novel antimicrobial strategies targeting this essential transporter.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.