Recombinant Pseudomonas aeruginosa Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Pseudomonas aeruginosa Lipoprotein Signal Peptidase (LspA) is a genetically engineered enzyme critical for processing bacterial lipoproteins. LspA, encoded by the lspA gene, cleaves signal peptides from prolipoproteins during their maturation, a step essential for proper localization and function of lipoproteins in bacterial membranes . In P. aeruginosa, LspA is a target for antibiotic development due to its role in virulence and survival .

Enzyme Structure

LspA is an aspartyl peptidase with a catalytic dyad (Asp124 and Asp143 in P. aeruginosa) that facilitates proteolytic cleavage . Structural studies reveal:

  • Active Site: A substrate-binding pocket accommodating lipobox motifs (e.g., -Leu-Ala/Ser-Ala-Cys*) .

  • Inhibitor Binding: Antibiotics like globomycin and myxovirescin block substrate access by mimicking the lipobox .

FeatureDescriptionSource OrganismReference
Catalytic residuesAsp124, Asp143P. aeruginosa PAO1
Inhibitor binding modesGlobomycin (β-cradle interaction), Myxovirescin (alternative pocket entry)S. aureus, P. aeruginosa

Recombinant Production

Recombinant LspA from P. aeruginosa PAO1 (UniProt: Q9HVM5) is produced in E. coli with the following specifications :

ParameterDetail
Product CodeCSB-EP872688EZX1
Purity>85% (SDS-PAGE)
Storage-20°C/-80°C (lyophilized: 12 months)
ReconstitutionDeionized water + 50% glycerol

Biological Role in P. aeruginosa

LspA processes lipoproteins involved in:

  • Virulence: Lipoproteins mediate adhesion, immune evasion, and nutrient uptake .

  • Antibiotic Resistance: Lipoprotein maturation affects membrane integrity and efflux pump function .

Key findings:

  • lspA is essential in P. aeruginosa, unlike in Gram-positive bacteria .

  • Deletion of lspA in methicillin-resistant Staphylococcus aureus (MRSA) reduces survival in human blood, highlighting its role in pathogenicity .

Inhibitors and Therapeutic Potential

LspA is a target for novel antibiotics due to its conserved mechanism and essentiality in Gram-negative pathogens .

InhibitorMechanismEfficacy in P. aeruginosaReference
GlobomycinMimics lipobox, blocks catalytic dyadIC50: 0.5 µM
Myxovirescin A1Binds adjacent to catalytic sitePotent activity

Structural studies of LspA-inhibitor complexes provide blueprints for designing broad-spectrum or species-specific drugs .

Research Applications

Recombinant LspA is used to:

  1. Study lipoprotein processing mechanisms .

  2. Screen inhibitors via biochemical assays (e.g., gel-shift assays with proICP substrate) .

  3. Validate antibiotic efficacy in in vitro and ex vivo infection models .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly indicate it in your order remarks. We will then prepare the protein according to your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery timelines, kindly consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; PSPA7_5199; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain PA7)
Target Names
lspA
Target Protein Sequence
MPEVDRFGRLPWLWITVLVFVLDQVSKAFFQAELSMYQQVVVIPDLFSWTLAYNTGAAFS FLADSSGWQRWLFALIAIVVSAILVVWLKRLKKGETWLAVALALVLGGALGNLYDRMVLG HVVDFILVHWQNRWYFPAFNLADSAITVGAVMLALDMFRSKKSGEAAHG
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein Signal Peptidase (LspA) and why is it significant in P. aeruginosa research?

LspA is an aspartyl protease that cleaves the transmembrane helix signal peptide of lipoproteins as part of the lipoprotein processing pathway. It has emerged as an excellent target for antibiotic development because it is essential in Gram-negative bacteria, important for virulence in Gram-positive bacteria, and may not readily develop antibiotic resistance . P. aeruginosa is a common opportunistic pathogen causing acute nosocomial pneumonia and chronic lung infections, particularly in cystic fibrosis patients . The bacterium's high pathogenicity combined with its increasing antibiotic resistance makes LspA an attractive therapeutic target.

The enzyme works in a multi-step pathway where bacterial preproproteins containing a signal peptide followed by a conserved lipobox sequence ([LVI][ASTVI][GAS]C) are processed sequentially. After translation, the preprolipoprotein is secreted through the inner membrane via Sec or Tat pathways, followed by modification by enzymes including LspA .

What are the key structural features of P. aeruginosa LspA?

The crystal structures of LspA reveal several important structural features:

  • A catalytic dyad of aspartate residues that forms the active site of this aspartyl protease

  • Fourteen additional highly conserved residues surrounding the active site

  • A flexible periplasmic helix (PH) that samples different conformations

  • A β-cradle structure that, together with the PH, helps "clamp" substrates in place

These extensively conserved residues in the active site indicate that resistance mutations would likely interfere with normal enzyme function, making LspA a powerful target to combat antibiotic resistance development . The periplasmic helix fluctuates on the nanosecond timescale and samples unique conformations in different states, which explains how LspA accommodates such a variety of substrates .

What detection methods can be used to study P. aeruginosa in related LspA research?

A rapid and sensitive detection method for P. aeruginosa based on recombinase polymerase amplification (RPA) combined with lateral flow strip (LFS) technology has been developed. This method:

  • Targets the unique virulence gene elastase B (lasB)

  • Can complete amplification at 37°C within 30 minutes

  • Allows results to be visualized by the naked eye within 10 minutes

  • Shows high sensitivity with a detection limit of 3.05 CFU/reaction

  • Demonstrates high specificity with no cross-reaction with other pathogenic bacteria

When tested with 574 clinical samples, this assay showed a 98.26% coincidence rate with traditional culture-biochemical methods and a kappa index value of 0.9433, indicating excellent reliability . This method could be valuable for researchers working with P. aeruginosa strains in LspA studies.

How do the conformational dynamics of LspA affect its function and interaction with inhibitors?

LspA exhibits remarkable conformational dynamics that are essential to its function:

  • The periplasmic helix fluctuates on the nanosecond timescale, sampling at least three distinct conformations: closed, intermediate, and open

  • In the apo (unbound) state, the dominant conformation is closed, which occludes the charged active site from the lipid bilayer

  • When bound to the antibiotic globomycin, the protein shows multiple binding modes with the periplasmic helix predominantly in a more open conformation

  • The open conformation is the only one that would sterically allow prolipoprotein to enter and bind in the active site in the correct orientation for signal peptide cleavage

These conformational changes are critical for both substrate processing and inhibitor binding. The different conformations observed in both bound and apo states indicate a flexible and adaptable active site, which explains how LspA accommodates and processes such a variety of substrates . For researchers, this suggests that targeting specific conformational states could be a strategy for inhibitor design.

What mechanisms contribute to resistance against LspA inhibitors in bacteria?

Several resistance mechanisms against LspA inhibitors have been identified:

  • In Escherichia coli, resistance to LspA inhibitors is mediated by deletion or decreased expression of the major outer membrane lipoprotein, Lpp (Braun's lipoprotein)

  • In Acinetobacter baumannii, researchers identified a previously uncharacterized highly abundant lipoprotein called LirL (LspA inhibitor resistance lipoprotein)

  • Deletion of lirL leads to resistance against the LspA inhibitor G5132, along with inefficient cell division, increased sensitivity to serum, and attenuated virulence

  • Signal peptide mutations that confer resistance lead to the accumulation of diacylglyceryl-modified LirL prolipoprotein without significant loss in cell viability

These mutations appear to overcome a block in lipoprotein biosynthetic flux by decreasing LirL prolipoprotein substrate sensitivity to processing by LspA . Understanding these resistance mechanisms is crucial for developing effective LspA-targeting antibiotics.

How has the interaction between LspA and globomycin informed antibiotic development?

Crystal structures of LspA from P. aeruginosa (LspPae) have been determined with the antibiotic globomycin bound, providing valuable insights:

  • Globomycin binding stabilizes an intermediate conformation of the LspA periplasmic helix

  • This conformation inhibits both signal peptide cleavage and substrate binding

  • The extensive conservation of active site residues suggests that resistance mutations would likely interfere with normal enzyme function

  • Multiple binding modes have been observed, indicating potential for optimizing inhibitor design

While globomycin itself is not commercially viable as an antibiotic, these structural studies provide hypotheses about substrate interactions, conformational changes, and the catalytic cycle that can guide the development of new antibiotics targeting LspA . The research validates lipoprotein biosynthesis as an antibacterial target in difficult-to-treat pathogens like A. baumannii .

What techniques are most effective for studying LspA conformational dynamics?

Based on current research, a hybrid experimental approach combining multiple techniques has proven most effective for studying LspA conformational dynamics:

  • Molecular Dynamics (MD) simulations: Used to observe conformational fluctuations on the nanosecond timescale

  • Electron Paramagnetic Resonance (EPR): Both continuous wave (CW) and double electron-electron resonance (DEER) methods are used to measure distances between different regions of the protein

  • X-ray crystallography: To capture specific conformational states, particularly with bound inhibitors

  • Site-directed spin labeling: To introduce probes for EPR measurements at specific protein locations

This multi-technique approach has been successful in identifying protein conformations not observed in crystal structures alone. The complementary nature of these methods allows researchers to correlate structural information with dynamic behavior, providing deeper insights into the functional dynamics of LspA that will aid future development of therapeutics .

How should researchers approach the expression and purification of recombinant P. aeruginosa LspA?

While the search results don't provide specific protocols for LspA expression and purification, general approaches for membrane proteins like LspA would include:

  • Expression systems: Using specialized E. coli strains (such as C41/C43) designed for membrane protein expression

  • Vector design: Incorporating fusion tags (His-tags, MBP) to aid in purification while maintaining protein folding and function

  • Extraction strategies: Screening multiple detergents (DDM, LDAO) or using styrene-maleic acid copolymer (SMA) to extract LspA in native-like lipid environments

  • Purification steps: Typically including immobilized metal affinity chromatography followed by size exclusion chromatography

  • Quality control: Employing circular dichroism, thermal shift assays, or activity measurements to verify proper folding and stability

For functional studies, reconstitution into proteoliposomes or nanodiscs may be necessary to provide a membrane-like environment that preserves native activity.

What experimental approaches can be used to evaluate potential LspA inhibitors?

For researchers developing LspA inhibitors, several experimental approaches would be valuable:

  • Biochemical assays: Using purified recombinant LspA to measure enzymatic activity in the presence of inhibitors

  • Structural studies: X-ray crystallography or cryo-EM to determine inhibitor binding modes

  • Conformational analysis: EPR and MD simulations to assess how inhibitors affect LspA dynamics

  • Antimicrobial susceptibility testing: Evaluating inhibitor efficacy against P. aeruginosa strains

  • Resistance development: Assessing the potential for resistance through serial passage experiments

Researchers should consider the membrane environment in their assay design, as this can significantly impact inhibitor binding and efficacy. Additionally, testing against panels of clinical isolates would provide information about spectrum and potency against diverse strains.

How can researchers interpret differences between crystal structures and solution-phase studies of LspA?

The research on LspA demonstrates that crystal structures alone may not capture the full conformational ensemble. The CW line shape analysis and DEER distance measurements show multiple distance populations in both apo and globomycin-bound states, suggesting that LspA samples multiple conformations (closed, intermediate, and open) in all states, though the populations vary .

When analyzing such data, researchers should:

  • Recognize that crystal structures represent single low-energy states while solution studies capture dynamic ensembles

  • Consider crystal packing artifacts that may stabilize non-physiological conformations

  • Use MD simulations starting from crystal structures to explore accessible conformational space

  • Validate with orthogonal experimental techniques like EPR or hydrogen-deuterium exchange

  • Consider the membrane environment's influence on conformational preferences

This integrated approach is essential for understanding the functional dynamics of membrane proteins like LspA and developing effective inhibitors targeting specific conformational states.

What considerations are important when studying LspA in the context of P. aeruginosa pathogenicity?

When studying LspA in the context of P. aeruginosa pathogenicity, researchers should consider:

  • P. aeruginosa is an opportunistic pathogen that rarely causes infections in people with healthy immune systems but can be serious and potentially deadly in immunocompromised individuals

  • The bacterium has evolved to develop antibiotic resistance, making infections challenging to treat

  • P. aeruginosa encodes multiple lipoproteins that play essential roles in adhesion, antibiotic resistance, virulence, invasion, and immune evasion

  • Early detection and monitoring of P. aeruginosa is crucial for controlling disease spread and implementing timely intervention

Understanding how LspA inhibition affects virulence factors, biofilm formation, and host-pathogen interactions will be crucial for assessing its potential as a therapeutic target. Researchers should design experiments that examine these factors in relevant infection models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.