Recombinant Pseudomonas aeruginosa Membrane protein glpM (glpM)

Shipped with Ice Packs
In Stock

Description

Key Properties of glpM

PropertyDescriptionSource
Protein Length109 amino acids (12,040 Da molecular weight)
LocalizationCytoplasmic membrane (integral membrane protein)
FunctionFacilitates efficient alginate biosynthesis from diverse carbon sources
Overexpression ImpactLethal when overexpressed in P. aeruginosa

glpM is expressed in E. coli with an N-terminal His-tag for purification and structural studies . Its hydrophobic nature suggests involvement in membrane-associated processes, such as glycerol metabolism or alginate synthesis .

Role in Alginate Biosynthesis

glpM is essential for optimal alginate production, particularly in P. aeruginosa strains with mucoid phenotypes (e.g., mucB mutants). Key findings include:

  • Carbon Source Utilization: glpM inactivation reduces alginate synthesis from glycerol, glucose, and other substrates .

  • Regulatory Interactions: glpM operates downstream of the glp regulon, which includes genes like glpD (glycerol-3-phosphate dehydrogenase) and glpF (glycerol uptake facilitator) .

Protein Interaction Network

glpM interacts with enzymes in glycerol metabolism and alginate biosynthesis pathways. Predicted partners include:

PartnerFunctionInteraction ScoreSource
glpDGlycerol-3-phosphate dehydrogenase0.855
glpFGlycerol diffusion facilitator0.575
glpKGlycerol kinase0.527
PA3710Probable GMC-type oxidoreductase0.692

These interactions suggest glpM coordinates glycerol uptake with metabolic flux toward alginate production .

Regulatory Mechanisms

The glp regulon is primarily controlled by GlpR, a DeoR family transcription factor. While glpM is not directly regulated by GlpR in E. coli, homology between P. aeruginosa and E. coli GlpR proteins implies conserved regulatory mechanisms .

  • Operator Sequences: Putative GlpR binding sites (e.g., OD1, OD2) are identified upstream of glpD and glpF, but not explicitly linked to glpM .

  • Cross-Regulation: AgmR (a response regulator) suppresses glpR2 mutants, but its role in glpM regulation remains unclear .

Recombinant Production and Applications

Recombinant glpM is produced in E. coli for structural and functional studies:

ParameterDetailsSource
Expression SystemT7 RNA polymerase-driven expression
PurificationNickel-affinity chromatography (His-tag)
Commercial AvailabilityAvailable as full-length protein (1–109 aa)

Applications include vaccine development and studies on membrane protein folding .

Research Implications

  • Pathogenicity: Alginate overproduction is linked to P. aeruginosa biofilm formation and antibiotic resistance. Targeting glpM could disrupt this process .

  • Metabolic Engineering: Modulating glpM expression may enhance glycerol utilization in industrial biotechnology .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
glpM; PA3585; Membrane protein GlpM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
glpM
Target Protein Sequence
MFKALIGAAVVVLLAVLSKTRNYYIAGLVPLFPTFALIAHYIVGKGRSLDDLKTTIVFGM WSIIPYFVYLAALYLLVERFRLETSLALAALAWLVAASVLVGLWVRLHA
Uniprot No.

Target Background

Function
Plays a potential role in alginate biosynthesis. Overexpression may be lethal.
Database Links

KEGG: pae:PA3585

STRING: 208964.PA3585

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal expression systems for producing recombinant P. aeruginosa membrane protein glpM?

For optimal results, researchers should consider:

  • Using bacteriophage T7 RNA polymerase-based vectors with tight regulation (pET series)

  • Testing multiple E. coli strains specialized for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3))

  • Employing lower induction temperatures (16-25°C) to slow protein production and reduce inclusion body formation

  • Incorporating fusion tags that enhance membrane targeting and solubility

If E. coli-based systems prove challenging, alternative expression systems such as Pichia pastoris or mammalian cell lines may provide better folding environments for complex membrane proteins, though at the cost of lower yields and more complex cultivation requirements .

How can researchers confirm successful membrane incorporation of recombinant glpM?

Verification of proper membrane incorporation is essential when working with recombinant membrane proteins like glpM. A multi-technique approach provides the most reliable confirmation:

  • Cell fractionation analysis: Separate cellular fractions (cytoplasmic, periplasmic, and membrane) using differential centrifugation protocols similar to those employed for isolating P. aeruginosa membrane fractions. Compare protein distribution across fractions using Western blot with anti-His or anti-glpM antibodies .

  • Membrane flotation assays: Mix membrane fractions with sucrose gradients and ultracentrifuge. Properly incorporated membrane proteins will float with the membrane fractions.

  • Protease accessibility assays: Treat intact cells or spheroplasts with proteases (e.g., trypsin). Properly oriented membrane proteins will show differential digestion patterns compared to misfolded variants.

  • Functional assays: Develop activity assays specific to glpM's function to verify not just incorporation, but proper folding and functionality.

  • Microscopy techniques: For fluorescently tagged constructs, confocal microscopy can visualize membrane localization patterns.

The combination of biochemical fractionation with functional verification provides the strongest evidence for successful membrane incorporation .

What purification strategies yield the highest purity and activity for recombinant glpM?

Purifying membrane proteins while maintaining their native structure and function presents significant challenges. For recombinant glpM, a systematic purification strategy yielding high purity and activity should include:

Step 1: Membrane isolation

  • Harvest cells and disrupt by pressure homogenization or sonication

  • Remove cellular debris with low-speed centrifugation (10,000 × g)

  • Collect membrane fraction by ultracentrifugation (100,000 × g)

  • Wash membranes to remove peripheral proteins

Step 2: Membrane protein solubilization

  • Screen detergents systematically (n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin)

  • Optimize detergent concentration, buffer composition, and ionic strength

  • Solubilize at 4°C with gentle agitation for 1-2 hours

Step 3: Affinity purification

  • Apply solubilized material to affinity resin specific to the incorporated tag

  • Develop gradient washing strategies to remove weakly bound contaminants

  • Elute using competitive elution or tag cleavage

Step 4: Size exclusion chromatography

  • Perform as final polishing step to separate aggregates and oligomeric states

  • Monitor detergent micelle size to distinguish protein-detergent complexes

Throughout the purification process, retention of functional activity should be monitored using binding assays or enzymatic activity measurements specific to glpM .

How should researchers design experiments to study interactions between antimicrobial peptides and recombinant glpM?

Designing experiments to study interactions between antimicrobial peptides (AMPs) and membrane proteins like glpM requires careful consideration of multiple variables. Based on successful approaches with other P. aeruginosa membrane proteins, a comprehensive experimental design should include:

Phase 1: Binding interaction studies

  • Employ pull-down assays using immobilized AMPs (similar to the hRNase 7-conjugated Sepharose approach) to capture glpM from membrane fractions

  • Verify specific binding through competition assays with excess free AMPs

  • Confirm interactions using surface plasmon resonance (SPR) with purified components to determine kinetic parameters (kon, koff, KD)

  • Implement isothermal titration calorimetry (ITC) to measure thermodynamic parameters

Phase 2: Structural characterization of interaction

  • Map binding regions through site-directed mutagenesis of predicted interaction sites

  • Use hydrogen-deuterium exchange mass spectrometry to identify protected regions upon binding

  • Consider cross-linking mass spectrometry to identify specific contact points

Phase 3: Functional consequences assessment

  • Measure membrane permeabilization using fluorescent dyes in liposomes containing reconstituted glpM

  • Assess bacterial viability in the presence of AMPs with wild-type versus glpM-deficient strains

  • Evaluate bacterial susceptibility to antibiotics in combination with AMPs targeting glpM

Controls should include testing with AMPs having different structures (α-helical versus β-sheet) and competition assays with other membrane components (e.g., LPS) that might influence binding .

What methods can effectively measure structural changes in glpM within bacterial outer membrane vesicles (OMVs)?

Measuring structural changes in membrane proteins within their native membrane environment represents a significant challenge. For glpM in bacterial outer membrane vesicles (OMVs), researchers can employ the following methodological approaches:

Spectroscopic methods:

  • Circular dichroism (CD) spectroscopy of isolated OMVs to detect secondary structure changes

  • Fluorescence spectroscopy using intrinsic tryptophan fluorescence or site-specific fluorescent labels

  • Fourier-transform infrared spectroscopy (FTIR) to monitor secondary structure alterations

Mass spectrometry-based approaches:

  • Limited proteolysis coupled with mass spectrometry to identify regions with altered accessibility

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to detect conformational changes based on solvent accessibility

  • Chemical cross-linking mass spectrometry to map distance constraints between protein regions

Microscopic techniques:

  • Electron microscopy of negatively stained OMVs to assess gross morphological changes

  • Cryo-electron microscopy for higher-resolution structural information

  • Atomic force microscopy to measure mechanical properties of OMVs containing wild-type versus mutant glpM

Functional assays:

  • Measure changes in membrane permeability using fluorescent dyes

  • Assess ion conductance across membranes containing wild-type versus structurally altered glpM

  • Monitor binding of known ligands as a proxy for structural integrity

When comparing different structural states, it's essential to maintain consistent OMV preparation methods and to validate findings using multiple orthogonal techniques .

How can researchers establish a standardized virulence assessment model for P. aeruginosa strains with modified glpM?

Establishing a standardized virulence assessment model for P. aeruginosa strains with modified glpM requires a multi-faceted approach that balances in vitro and in vivo methods. Building on recent advances in P. aeruginosa virulence quantification methods:

In vitro virulence assessment:

  • Cell culture invasion assays using epithelial cell lines

  • Biofilm formation quantification

  • Type III secretion system activity measurement

  • Resistance to host immune factors (complement, antimicrobial peptides)

Galleria mellonella infection model:
The Galleria mellonella model offers an efficient system for comparative virulence assessment. For P. aeruginosa with modified glpM, implement the following standardized protocol:

  • Use age-standardized final instar larvae (250-300 mg weight range)

  • Maintain larvae at 37°C throughout the experiment

  • Prepare bacterial inocula from cultures at mid-log phase

  • Inject standardized inocula (10 μL volume) into the last left proleg

  • Monitor larvae at defined intervals (2, 4, 8, 12, 24, 36, 48 hours)

  • Calculate LT50 (time to 50% mortality) rather than LD50

  • Include appropriate controls: PBS injection, wild-type strain, and reference strain

The use of LT50 at a defined inoculum (rather than traditional LD50) provides more reproducible results for highly virulent P. aeruginosa strains. For quality control, include a reference strain with established LT50 in each experiment to normalize results across laboratories .

Table 1: Recommended Parameters for Galleria mellonella Infection Model with glpM-Modified Strains

ParameterRecommendationRationale
Larvae ageFinal instarStandardizes immunity status
Larvae weight250-300 mgReduces dose-weight variation
Bacterial growth phaseMid-log (OD600 0.5-0.7)Ensures consistent virulence expression
Inoculum size10-50 CFUOptimal for detecting LT50 differences
Temperature37°CMimics human host environment
Monitoring intervalsEvery 2-4h for first 24hCaptures critical death kinetics
Primary metricLT50More sensitive than LD50 for P. aeruginosa
Minimum replicates30 larvae per strainEnsures statistical power

This framework provides a reproducible methodology for quantifying virulence differences between wild-type and glpM-modified P. aeruginosa strains .

What multi-factor experimental designs best elucidate glpM's role in antimicrobial resistance mechanisms?

To thoroughly investigate glpM's role in antimicrobial resistance mechanisms, researchers should implement multi-factor experimental designs that systematically explore interactions between genetic, environmental, and pharmacological variables. Based on established approaches for multi-factor analysis in microbiology:

Factorial experimental design approach:
A 2^k factorial design (where k = number of factors) allows for systematic exploration of main effects and interactions between variables. For glpM studies, consider including:

  • Genetic factors: wild-type vs. glpM knockout vs. glpM point mutations vs. glpM overexpression

  • Environmental conditions: low vs. high Mg²⁺ concentration (to manipulate membrane stability)

  • Antimicrobial agents: different classes (polymyxins, cationic AMPs, conventional antibiotics)

  • Physiological state: planktonic vs. biofilm growth

This approach requires appropriate replication to include interaction terms in the general linear model (GLM) analysis. Include within-experiment replicates (technical) and between-experiment replicates (biological) to account for variability sources .

Response surface methodology:
For quantitative factors (e.g., antimicrobial concentration, expression levels), response surface designs can map the continuous response landscape, revealing optimal conditions and thresholds for resistance mechanisms.

Time-series experimental design:
Incorporate time as an explicit factor to assess temporal dynamics of resistance development in relation to glpM expression. Analyze with repeated-measures ANOVA or mixed-effects models.

Statistical analysis considerations:

  • Test assumptions of multi-factor GLMs (normality, homoscedasticity)

  • Address non-independence in experimental designs

  • Apply appropriate post-hoc tests with correction for multiple comparisons

  • Report effect sizes alongside p-values to assess biological significance

By systematically varying these factors and analyzing interactions statistically, researchers can distinguish direct effects of glpM from context-dependent mechanisms of antimicrobial resistance .

How can researchers effectively compare the structural features of glpM with other membrane proteins using computational methods?

Computational approaches provide powerful tools for comparing structural features of membrane proteins like glpM with related proteins. A comprehensive computational analysis workflow should include:

Sequence-based structure prediction:

  • Generate multiple sequence alignments of glpM with homologous proteins using MUSCLE or MAFFT algorithms

  • Identify conserved domains and motifs using PFAM, InterPro, and PROSITE databases

  • Predict transmembrane topology using consensus approaches (TMHMM, TOPCONS, MEMSAT)

  • Analyze patterns of evolutionary conservation using ConSurf to identify functionally important residues

3D structure prediction and validation:

  • Generate predicted structures using AlphaFold2 or RoseTTAFold, which have demonstrated high accuracy for membrane proteins

  • Validate predicted structures through QMEANBrane and ProQ3D membrane-specific quality metrics

  • Refine structures in simulated membrane environments using molecular dynamics simulations

Structural comparison methodology:

  • Perform structural alignment using DALI, TM-align, or FATCAT algorithms

  • Calculate RMSD values for backbone atoms in aligned regions

  • Identify structurally conserved motifs that may indicate functional sites

  • Analyze electrostatic surface potential using APBS to identify potential interaction sites

  • Map sequence conservation onto structural models to highlight functionally important regions

Molecular dynamics simulation approach:

  • Embed predicted structures in appropriate membrane models (POPC or mixed lipid bilayers)

  • Run extended simulations (>100 ns) to assess structural stability and conformational dynamics

  • Analyze water and ion permeation pathways through potential channels or pores

  • Calculate lipid-protein interaction energies to identify potential lipid binding sites

Table 2: Recommended Computational Tools for glpM Structural Analysis

Analysis TypeRecommended ToolsOutput Metrics
Transmembrane topologyTMHMM, TOPCONS, MEMSATTM helix positions, orientation
3D structure predictionAlphaFold2, RoseTTAFoldFull atom coordinates, confidence scores
Quality assessmentQMEANBrane, ProQ3DGlobal and local quality scores
Structural alignmentDALI, TM-alignRMSD, TM-score, aligned regions
Evolutionary analysisConSurf, EvolutionaryTraceConservation scores per residue
Molecular dynamicsGROMACS, NAMD, AMBERRMSD, RMSF, hydrogen bonds, salt bridges

This systematic computational approach provides researchers with robust predictions about glpM structure and function that can guide experimental design .

What analytical techniques best resolve contradictions in experimental data on glpM function?

When confronted with contradictory experimental results regarding glpM function, researchers should employ a systematic analytical approach to resolve these discrepancies. Based on best practices in membrane protein research:

Step 1: Critical evaluation of experimental conditions

  • Compare buffer compositions, especially divalent cation concentrations (Mg²⁺, Ca²⁺) which dramatically affect membrane protein function

  • Assess detergent types and concentrations used in different studies

  • Review protein preparation methods (expression systems, purification protocols)

  • Evaluate assay conditions (temperature, pH, ionic strength)

Step 2: Meta-analysis of existing data

  • Perform statistical re-analysis of raw data when available

  • Apply Bayesian approaches to integrate findings with different uncertainty levels

  • Conduct sensitivity analyses to identify variables driving contradictory results

Step 3: Orthogonal experimental approaches

  • Implement complementary assay systems that measure the same function through different mechanisms

  • Combine in vitro biochemical assays with in vivo functional studies

  • Apply site-directed mutagenesis to test specific mechanistic hypotheses

Step 4: Resolution through standardized protocols
Similar to the standardization of virulence assessment in P. aeruginosa, develop consensus protocols for glpM functional assays, including:

  • Standardized protein preparation methods

  • Defined buffer compositions with physiologically relevant ion concentrations

  • Calibrated activity measurements against reference standards

  • Inclusion of appropriate positive and negative controls

Step 5: Advanced biophysical characterization

  • Apply single-molecule techniques to distinguish heterogeneous populations

  • Use native mass spectrometry to identify different oligomeric states

  • Implement hydrogen-deuterium exchange mass spectrometry to detect conformational differences

When bactericidal activity results conflict, consider the influence of divalent cations (like Mg²⁺) and competing LPS, which have been shown to dramatically affect antimicrobial activity against P. aeruginosa in different assay systems .

How does the lipid environment affect the function and stability of recombinant glpM?

The lipid environment critically influences membrane protein function and stability. For recombinant glpM, researchers should consider how lipid composition affects protein behavior across different experimental systems:

Impact of lipid composition:
The lipid composition of P. aeruginosa membranes differs significantly from expression hosts like E. coli. Analysis of native P. aeruginosa membranes shows that they contain unique lipid A species with specific acylation patterns. These distinct lipid environments can significantly impact:

  • Protein folding and topological arrangement

  • Conformational flexibility and dynamics

  • Oligomeric state and stability

  • Functional activity and ligand binding

Experimental approaches to assess lipid effects:

  • Reconstitution studies: Purify glpM and reconstitute into liposomes with defined lipid compositions

  • Lipid exchange methods: Gradually replace detergent micelles with specific lipids using cyclodextrin-mediated exchange

  • Native nanodiscs: Incorporate glpM into nanodiscs with native P. aeruginosa lipids

  • Styrene maleic acid lipid particles (SMALPs): Extract glpM with surrounding native lipids

Critical parameters to control:

  • Acyl chain length and saturation

  • Headgroup composition and charge

  • Presence of specific lipids (phosphatidylethanolamine, cardiolipin)

  • Lipid asymmetry between membrane leaflets

  • Lipid A modifications (acylation patterns)

Research with other P. aeruginosa membrane proteins has demonstrated that lipid A acylation patterns critically affect protein function. For example, hexa-acylated versus hepta-acylated lipid A species in outer membrane vesicles showed distinct functional properties. When working with recombinant glpM, researchers should consider the native lipid environment of P. aeruginosa and how it differs from expression systems .

What strategies effectively overcome expression challenges for potentially toxic membrane proteins like glpM?

Expression of potentially toxic membrane proteins like glpM presents significant challenges that can be addressed through strategic modifications to expression systems and protocols:

Challenge 1: Leaky expression causing toxicity

  • Implement tightly regulated expression systems (T7-lac, araBAD, tetA)

  • Use expression hosts with reduced basal transcription (BL21(DE3)pLysS, C41(DE3))

  • Employ glucose catabolite repression to minimize leaky expression

  • Consider cell-free expression systems that bypass toxicity issues

Challenge 2: Protein misfolding and aggregation

  • Express as fusion proteins with highly soluble partners (MBP, SUMO, Mistic)

  • Co-express with specific chaperones (GroEL/ES, DnaK/J)

  • Reduce expression rate through lower temperatures (16-25°C)

  • Use specialized E. coli strains evolved for membrane protein expression

Challenge 3: Overwhelming membrane insertion machinery

  • Utilize low inducer concentrations for controlled expression rates

  • Implement autoinduction media for gradual protein production

  • Co-express membrane insertion machinery components (YidC, SecYEG)

  • Design constructs with optimal signal sequences for membrane targeting

Challenge 4: Instability of expression constructs

  • Design synthetic genes with optimized codon usage

  • Remove toxic sequence elements that might affect plasmid stability

  • Use low-copy number plasmids with appropriate antibiotic selection

  • Monitor construct stability throughout expression

Innovative approaches:

  • Inducible lysis systems: Express toxic proteins just before harvesting cells

  • Split protein complementation: Express protein as separate fragments that reassemble

  • Periplasmic expression: Target protein to periplasm to reduce cytoplasmic toxicity

  • Directed evolution: Select for expression host variants that tolerate target protein

The successful expression of other P. aeruginosa membrane proteins has been achieved through systematic optimization of these parameters, with particular attention to tight regulation of expression and appropriate fusion partners .

How can researchers distinguish between direct effects of glpM and indirect effects through lipopolysaccharide (LPS) interactions?

Distinguishing direct effects of membrane proteins like glpM from indirect effects mediated through lipopolysaccharide (LPS) interactions presents a significant challenge in P. aeruginosa research. Addressing this requires carefully designed experimental approaches:

Experimental strategies for distinguishing direct vs. LPS-mediated effects:

  • Genetic complementation analysis:

    • Compare wild-type, glpM knockout, and complemented strains

    • Include complementation with site-directed mutants affecting potential LPS interaction sites

    • Analyze LPS profiles in all strains to identify potential structural changes

  • Biochemical separation approaches:

    • Develop protocols for purifying glpM with and without associated LPS

    • Implement specific LPS extraction and depletion procedures

    • Reconstitute purified glpM into defined lipid systems with and without LPS

  • Competition assays:

    • Use exogenous LPS from different bacterial sources as competitors

    • Determine if LPS competition affects glpM-dependent processes

    • Compare effects of structurally diverse LPS variants

  • Direct binding assays:

    • Develop binding assays between purified glpM and LPS

    • Characterize binding kinetics and affinity using surface plasmon resonance

    • Identify binding determinants through site-directed mutagenesis

Control experiments for LPS contamination:

  • Implement endotoxin testing protocols for all protein preparations

  • Include polymyxin B treatments to neutralize LPS effects

  • Use LPS from different bacterial species as specificity controls

Research on other P. aeruginosa membrane proteins has shown that antimicrobial activity can be differentially affected by exogenous LPS from different sources. For example, the bactericidal activity of hRNase 7 against P. aeruginosa was more severely inhibited by E. coli LPS than by P. aeruginosa LPS, suggesting specific LPS-protein interactions that influence function .

What combination of techniques provides the most comprehensive structural characterization of glpM?

A comprehensive structural characterization of membrane proteins like glpM requires integrating multiple complementary techniques to overcome the limitations of individual methods. Based on current approaches in membrane protein structural biology:

X-ray crystallography approach:

  • Express glpM with fusion partners that facilitate crystallization (T4 lysozyme, BRIL)

  • Screen diverse detergents and lipidic cubic phase conditions

  • Implement surface entropy reduction mutations to enhance crystal contacts

  • Consider antibody fragment co-crystallization to stabilize specific conformations

Cryo-electron microscopy:

  • Optimize sample preparation conditions (grid type, freezing parameters)

  • Consider reconstitution into nanodiscs or amphipols for enhanced stability

  • Implement image processing workflows optimized for smaller membrane proteins

  • Use focused refinement techniques for flexible regions

NMR spectroscopy:

  • Prepare isotopically labeled protein (¹⁵N, ¹³C, ²H) in detergent micelles

  • Implement TROSY-based experiments for larger membrane protein systems

  • Measure residual dipolar couplings for long-range structural constraints

  • Consider solid-state NMR for protein reconstituted in native-like lipid bilayers

Integrative structural biology approach:
Combining data from multiple experimental sources with computational modeling provides the most complete structural characterization:

  • Use low-resolution structural data (SAXS, negative-stain EM) to define molecular envelope

  • Incorporate distance constraints from crosslinking mass spectrometry

  • Add topological information from accessibility studies and evolutionary analysis

  • Refine models using molecular dynamics simulations in explicit membrane environments

  • Validate structures through functional mutation studies

Table 3: Complementary Structural Techniques for glpM Characterization

This multi-technique approach has proven successful for other P. aeruginosa membrane proteins, providing complementary information that no single method could deliver .

How does the oligomeric state of glpM affect its functional properties and interactions with antimicrobial peptides?

The oligomeric state of membrane proteins significantly influences their functional properties and interactions with ligands. For glpM and its interactions with antimicrobial peptides, researchers should systematically investigate the relationship between oligomerization and function:

Determining native oligomeric state:

  • Analytical ultracentrifugation: Sedimentation velocity and equilibrium experiments in detergent

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS): Determine absolute molecular mass

  • Native mass spectrometry: Directly measure oligomeric species

  • Chemical crosslinking: Capture transient interactions between subunits

  • FRET-based assays: Measure proximity between fluorescently labeled subunits

Functional implications of oligomerization:
Based on studies of other P. aeruginosa membrane proteins like OprI, which is predicted to form a trimeric α-helical structure, the oligomeric state of membrane proteins can affect:

  • Binding sites for antimicrobial peptides

  • Conformational changes upon ligand binding

  • Channel or pore formation through the membrane

  • Resistance to detergent solubilization or proteolytic degradation

Experimental approaches to link structure and function:

  • Mutagenesis of oligomerization interfaces: Disrupt specific intersubunit interactions

  • Covalent locking of oligomeric states: Introduce disulfide bridges to stabilize specific configurations

  • Heteromeric constructs: Co-express wild-type and mutant variants to assess dominant-negative effects

  • Controlled reconstitution: Vary protein-to-lipid ratios to manipulate oligomeric distribution

Impact on antimicrobial peptide interactions:
The oligomeric arrangement of membrane proteins can create unique binding sites for antimicrobial peptides. For example, OprI of P. aeruginosa consists of an extended loop at the N-terminus for antimicrobial peptide/LPS binding, a trimeric α-helix, and a C-terminal lysine residue for cell wall anchoring. This structural arrangement creates specific interaction sites for antimicrobial peptides that may not exist in the monomeric state .

What are the most effective protocols for assessing glpM's role in membrane permeability and antibiotic resistance?

Assessing membrane protein contributions to bacterial membrane permeability and antibiotic resistance requires robust protocols that can detect subtle functional differences. For glpM, researchers should implement complementary approaches:

Membrane permeability assays:

  • Fluorescent dye accumulation:

    • Use membrane-impermeant dyes (propidium iodide, SYTOX Green)

    • Measure fluorescence increase upon membrane permeabilization

    • Compare uptake kinetics between wild-type and glpM-modified strains

    • Include positive controls (polymyxin B) and negative controls (PBS)

  • Liposome-based permeability studies:

    • Reconstitute purified glpM into liposomes containing self-quenching dyes

    • Measure dye release upon addition of antimicrobial agents

    • Vary lipid composition to mimic different membrane environments

    • Control protein-to-lipid ratios to normalize for insertion efficiency

  • Electrophysiology approaches:

    • Perform patch-clamp studies on proteoliposomes containing glpM

    • Use planar lipid bilayer recordings to measure single-channel conductance

    • Assess ion selectivity through reversal potential measurements

    • Examine effects of antimicrobial peptides on channel properties

Antibiotic resistance assessment:

  • Minimum inhibitory concentration (MIC) determination:

    • Compare MICs for various antibiotics against wild-type and glpM-modified strains

    • Use broth microdilution method following CLSI guidelines

    • Include appropriate quality control strains

    • Test in different media compositions to assess environmental effects

  • Synergy testing protocols:

    • Implement checkerboard assays to measure interactions between antibiotics

    • Calculate fractional inhibitory concentration indices (FICI)

    • Test combinations of membrane-active and non-membrane-active antibiotics

    • Include antimicrobial peptides known to interact with membrane proteins

  • Time-kill kinetics:

    • Measure bacterial killing rates over time

    • Compare wild-type and glpM-modified strains

    • Assess concentration-dependent versus time-dependent killing

    • Evaluate post-antibiotic effects

Studies with other P. aeruginosa membrane proteins have shown that membrane modifications can dramatically alter susceptibility to antimicrobial agents. For example, elimination of virulence factors from wild-type P. aeruginosa affected membrane permeability and resistance profiles. When assessing glpM's role, consideration of specific membrane composition changes is essential for accurate interpretation of results .

How can research findings on recombinant glpM contribute to novel antimicrobial strategies against P. aeruginosa?

Research on recombinant membrane proteins like glpM can significantly advance the development of novel antimicrobial strategies against P. aeruginosa through multiple pathways. Based on successful approaches with other P. aeruginosa membrane proteins:

Target-based drug discovery:

  • Structure-based design of small molecule inhibitors targeting functional domains of glpM

  • Fragment-based screening approaches to identify novel binding scaffolds

  • Rational design of peptide mimetics that disrupt essential protein-protein interactions

  • Development of allosteric modulators that alter protein conformation and function

Immunotherapeutic approaches:
Learning from outer membrane vesicle (OMV) vaccine development against P. aeruginosa, recombinant glpM could contribute to:

  • Design of subunit vaccines using purified recombinant glpM

  • Development of antibody-antibiotic conjugates targeting exposed epitopes

  • Creation of immunomodulatory strategies enhancing host defense recognition

  • Engineering of chimeric antigens fusing glpM epitopes with immunogenic carriers

Membrane-targeting strategies:

  • Design of peptides that specifically recognize and bind glpM, disrupting membrane integrity

  • Development of nanoparticle drug delivery systems with enhanced affinity for glpM

  • Creation of molecular decoys that compete with glpM for essential interaction partners

  • Formulation of combination therapies targeting multiple membrane components simultaneously

Research with P. aeruginosa outer membrane proteins has already demonstrated the feasibility of developing effective vaccines. For example, recombinant P. aeruginosa OMVs carrying the PcrV-HitA fusion gene provided 70% protection against intranasal challenge in animal models. Similar approaches leveraging glpM as a target or delivery vehicle could yield promising new therapeutic strategies .

What are the critical considerations for translating in vitro findings on glpM to in vivo infection models?

Translating in vitro research findings on membrane proteins like glpM to relevant in vivo infection models requires addressing several critical considerations to ensure predictive value:

Physiological expression and regulation:

  • Verify that expression levels in laboratory conditions reflect those in infection environments

  • Assess regulation of glpM expression under different host-mimicking conditions

  • Consider strain variation in glpM sequence and expression across clinical isolates

  • Evaluate post-translational modifications that may occur in vivo but not in vitro

Host-pathogen interaction factors:

  • Account for host immune components (complement, antimicrobial peptides) that interact with membrane proteins

  • Consider the impact of host microenvironment (pH, ion concentrations, oxygen tension)

  • Evaluate biofilm formation effects on membrane protein exposure and function

  • Assess contribution of other virulence factors that may compensate for glpM alterations

Model selection considerations:

  • Choose infection models appropriate for the specific research question

  • Consider anatomical site relevance (respiratory, wound, systemic models)

  • Select models that recapitulate key aspects of human disease

  • Validate findings across multiple model systems

Standardization and quality control:

  • Implement standardized protocols with appropriate controls

  • Define clear metrics for virulence assessment (LT50 rather than LD50 for highly virulent strains)

  • Include reference strains with known virulence profiles

  • Account for host variable factors (age, immune status, microbiome)

What future research directions will advance our understanding of glpM's role in P. aeruginosa pathogenesis?

Future research on glpM should focus on integrating structural insights with functional studies and clinical relevance. Key research directions include:

Structural biology frontiers:

  • Determine high-resolution structures of glpM in different functional states

  • Map conformational changes associated with ligand binding or environmental conditions

  • Identify allosteric networks within the protein that regulate activity

  • Characterize protein-protein interaction interfaces with host factors

Systems biology approaches:

  • Apply multi-omics techniques to map glpM's role in cellular networks

  • Investigate epistatic interactions with other membrane components

  • Develop predictive models of membrane function incorporating glpM activity

  • Explore evolutionary patterns across clinical isolates with varying virulence

Host-pathogen interaction studies:

  • Characterize interactions between glpM and host immune components

  • Investigate contribution to immune evasion strategies

  • Assess role in biofilm formation and antibiotic tolerance

  • Determine importance in different infection contexts (acute vs. chronic)

Translational research priorities:

  • Develop high-throughput screening assays for glpM inhibitors

  • Evaluate glpM as a diagnostic or prognostic biomarker

  • Assess potential as a vaccine antigen or drug target

  • Investigate synergistic approaches combining glpM targeting with conventional antibiotics

Innovative methodological approaches:

  • Implement CRISPR interference for precise temporal regulation of glpM expression

  • Develop fluorescent reporters to monitor glpM localization and dynamics in living cells

  • Apply single-cell techniques to assess heterogeneity in glpM function

  • Utilize synthetic biology approaches to engineer membrane systems with defined properties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.