Recombinant Pseudomonas aeruginosa Na (+)-translocating NADH-quinone reductase subunit D (nqrD)

Shipped with Ice Packs
In Stock

Description

Role in the NQR Complex

The NQR complex in P. aeruginosa consists of six subunits (A–F), with nqrD (subunit D) contributing to electron transfer and ion pumping. Unlike homologous complexes in Vibrio spp., P. aeruginosa NQR (Pa-NQR) exhibits unique characteristics:

  • Proton-Pumping Activity: Pa-NQR functions as a proton pump rather than a sodium pump, diverging from other bacterial NQR systems. Molecular dynamics simulations attribute this to differences in ion channel residues .

  • Electron Transfer: Couples NADH oxidation to ubiquinone reduction, generating a proton gradient for ATP synthesis and nutrient transport .

  • Cofactor Composition: Contains four flavin cofactors but lacks the neutral riboflavin radical typical of NQR homologs .

Functional Advantages in P. aeruginosa Metabolism

Pa-NQR dominates NADH dehydrogenase activity in stationary-phase cells, accounting for 75–95% of electron flux . Key advantages include:

  • Iron Efficiency: Requires fewer iron-sulfur clusters than Complex I, conserving iron under host-imposed scarcity .

  • Reduced Oxidative Stress: Minimizes reactive oxygen species (ROS) production compared to Complex I, enhancing survival in hostile environments .

  • HQNO Resistance: Resists inhibition by 2-n-heptyl-4-hydroxyquinoline N-oxide (HQNO), a quorum-sensing toxin secreted by P. aeruginosa. Mutagenesis studies identify residues 151 and 155 in subunit B as critical for this resistance .

Applications in Research and Drug Development

Recombinant nqrD facilitates studies targeting bacterial energy metabolism:

  • Pathogenicity Studies: NQR is essential for P. aeruginosa survival during infection, making it a potential antimicrobial target .

  • Structural Analysis: Used in homology modeling to map ion channels and inhibitor-binding sites .

  • Comparative Biochemistry: Highlights evolutionary adaptations in prokaryotic respiratory chains .

Key Research Findings

Recent studies reveal critical insights:

  1. Cation Selectivity: Pa-NQR’s proton-pumping mechanism is linked to sequence variations in ion exit channels (e.g., subunit F) .

  2. HQNO Interaction: Partial inhibition of Pa-NQR allows P. aeruginosa to survive self-produced HQNO, conferring a competitive edge against rival bacteria .

  3. Metabolic Flexibility: NQR’s dominance in stationary phase supports biofilm formation and antibiotic tolerance .

Future Directions

Ongoing research aims to:

  • Develop NQR inhibitors targeting P. aeruginosa without affecting human cells.

  • Engineer recombinant NQR variants to dissect structure-function relationships.

  • Explore cross-species differences in ion-pumping mechanisms for evolutionary insights .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific requirement for the format, please indicate your preference in the order notes. We will endeavor to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you may use as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize development of the specified tag.
Synonyms
nqrD; PA2996; Na(+-translocating NADH-quinone reductase subunit D; Na(+-NQR subunit D; Na(+-translocating NQR subunit D; NQR complex subunit D; NQR-1 subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
nqrD
Target Protein Sequence
MMAAQPTIREVLFNPVFQNNPIGLQILGICSALAVTSNLKTATVMAIALTLVTGFSNLFI SMIRRQIPSSIRMIVQMVIIASLVIVVDQVLKAYAYSLSKQLSVFVGLIITNCIVMGRAE AFAMANPPLVSFFDGIGNGLGYSAMLLVLGFVRELFGAGKLYGISVLPTVNDGGWYQPNG LLLLPPSAFFLIGLIIWALRTWKKDQVEAPTYKMAPQVSSKEAY
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two successive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: pae:PA2996

STRING: 208964.PA2996

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of nqrD in the Pseudomonas aeruginosa NQR complex?

NqrD is one of six subunits (NqrA-F) that form the Na(+)-translocating NADH:quinone oxidoreductase (NQR) complex in Pseudomonas aeruginosa. While NQR typically functions as a sodium pump in most bacteria, P. aeruginosa has evolved a unique variant that acts as a proton pump. Within this complex, nqrD likely contributes to the ion channel structure that determines cation selectivity and transport. The comprehensive characterization of Pa-NQR indicates that the exit ion channels, which nqrD contributes to forming, play a crucial role in determining whether the complex pumps sodium or proton ions .

Methodologically, researchers can investigate nqrD's specific role through site-directed mutagenesis of conserved residues followed by functional assays measuring proton translocation rates in reconstituted proteoliposomes. Comparing wild-type and mutant forms allows identification of amino acids critical for proton selectivity and transport.

How does nqrD's structure differ between P. aeruginosa and other bacterial species?

The unique proton-pumping function of Pa-NQR suggests structural differences in nqrD compared to sodium-pumping NQR homologs from other bacteria. Homology modeling and molecular dynamics simulations indicate that these differences likely reside in the transmembrane regions of nqrD that contribute to ion channels .

To investigate these differences, researchers should employ comparative sequence analysis of nqrD across multiple bacterial species, focusing on conserved and divergent residues. This can be complemented with structural prediction tools and molecular dynamics simulations to identify potential proton-binding sites and translocation pathways. X-ray crystallography or cryo-electron microscopy of the recombinant nqrD can provide direct structural evidence, though these techniques require significant optimization for membrane proteins.

How is nqrD expression regulated in P. aeruginosa?

The expression of nqrD, as part of the nqr operon, appears to be constitutive rather than condition-dependent in P. aeruginosa. Unlike some bacteria that switch between different NADH dehydrogenases under varying conditions, P. aeruginosa maintains expression of all three NADH dehydrogenases (NQR, NDH2, and NUO) simultaneously to ensure metabolic resilience .

To study nqrD regulation, researchers can use quantitative PCR to measure transcript levels under various growth conditions (aerobic/anaerobic, different carbon sources, pH variations). Reporter gene assays using the nqr promoter fused to fluorescent proteins can visualize expression patterns. Chromatin immunoprecipitation followed by sequencing (ChIP-seq) can identify transcription factors that bind to the nqr operon regulatory regions.

How does recombinant nqrD interact with other NQR subunits to form a functional proton pump?

Understanding subunit interactions within the NQR complex is crucial for elucidating the mechanism of proton pumping. Based on current research, nqrD likely forms specific interactions with adjacent subunits to create the ion translocation pathway that determines cation selectivity .

Methodologically, researchers should employ co-immunoprecipitation experiments with tagged recombinant nqrD to identify direct protein-protein interactions. Crosslinking studies followed by mass spectrometry can map the specific residues involved in these interactions. Bacterial two-hybrid assays or fluorescence resonance energy transfer (FRET) can validate these interactions in vivo. For more detailed structural information, single-particle cryo-electron microscopy of the assembled complex provides insights into the spatial arrangement of subunits and conformational changes during the catalytic cycle.

What is the role of nqrD in HQNO resistance of Pa-NQR?

To investigate this, researchers should conduct comparative binding assays with radiolabeled or fluorescent HQNO using wild-type and nqrD-mutated complexes. Site-directed mutagenesis of conserved residues in nqrD followed by HQNO inhibition assays can identify regions that contribute to resistance. Molecular docking simulations can predict potential interaction sites between HQNO and nqrD. Additionally, measuring the effects of HQNO on proton pumping activity in reconstituted proteoliposomes containing wild-type or mutant complexes can reveal functional consequences of these interactions.

How does the proton-pumping mechanism of Pa-NQR involving nqrD differ from sodium-pumping in other bacterial NQRs?

The remarkable evolutionary shift from sodium to proton pumping in Pa-NQR represents a significant adaptation with potential implications for bacterial physiology and pathogenesis. Understanding the mechanistic differences involves detailed characterization of the ion channels, which nqrD contributes to forming .

Researchers should perform comparative electrophysiological measurements of ion currents in reconstituted proteoliposomes containing either Pa-NQR or sodium-pumping NQRs from other bacteria. pH-dependent activity assays can identify optimal conditions for proton pumping. Isotope exchange experiments using deuterium oxide can measure proton translocation rates. Molecular dynamics simulations with explicit water molecules can visualize potential proton-wire mechanisms. Site-directed mutagenesis of conserved residues in nqrD, followed by functional assays, can identify critical amino acids involved in the proton selectivity filter.

What are the optimal conditions for expressing and purifying recombinant P. aeruginosa nqrD?

Membrane proteins like nqrD present unique challenges for recombinant expression and purification. Based on approaches used for similar proteins, researchers can optimize their protocols accordingly.

For expression, E. coli C41(DE3) or C43(DE3) strains typically yield better results for membrane proteins compared to standard BL21(DE3). Expression should be induced at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) to prevent inclusion body formation. Adding membrane-stabilizing agents like glycerol (5-10%) to growth media can improve yields. For purification, solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration preserves protein structure. Purification can be achieved using immobilized metal affinity chromatography with a C-terminal His-tag, followed by size exclusion chromatography. Protein quality should be assessed using circular dichroism to confirm proper folding .

What techniques are most effective for studying the structure-function relationship of nqrD in the context of proton pumping?

Understanding the structure-function relationship of nqrD requires a multidisciplinary approach combining structural biology, biochemistry, and biophysics.

Researchers should employ a combination of: (1) Site-directed mutagenesis targeting conserved residues in predicted proton channels, followed by activity assays measuring NADH oxidation rates spectrophotometrically at 340 nm. (2) Reconstitution of purified wild-type or mutant NQR complexes into proteoliposomes with pH-sensitive fluorescent dyes like ACMA to measure proton translocation. (3) Hydrogen-deuterium exchange mass spectrometry to identify regions with differential solvent accessibility during the catalytic cycle. (4) Electron paramagnetic resonance (EPR) spectroscopy to track conformational changes and detect transient radical intermediates. (5) Molecular dynamics simulations using the homology model to predict proton pathways and energetics of ion translocation .

How can recombinant nqrD be integrated into functional NQR complexes for in vitro studies?

Reconstituting functional NQR complexes containing recombinant nqrD is essential for studying the protein's role in proton pumping and HQNO resistance.

The most effective approach involves co-expression of all six NQR subunits (NqrA-F) in a suitable host like E. coli, with nqrD containing a removable affinity tag for purification. Alternatively, researchers can express and purify individual subunits, then reconstitute the complex in vitro using a step-wise assembly protocol in the presence of appropriate lipids and detergents. The assembled complex should be verified for completeness using blue native PAGE, and for functionality by measuring NADH:ubiquinone oxidoreductase activity. For incorporation into proteoliposomes, the purified complex should be mixed with phospholipids (typically a mixture of E. coli polar lipids and phosphatidylcholine), followed by detergent removal using Bio-Beads or dialysis. The resulting proteoliposomes can be used for proton pumping assays using pH-sensitive fluorescent dyes or pH electrodes .

What mutations in nqrD might alter proton selectivity based on computational modeling?

Based on homology modeling and molecular dynamics simulations of the NQR complex, several key residues in nqrD potentially contribute to proton selectivity over sodium ions. These predictions provide valuable targets for site-directed mutagenesis experiments.

Residue PositionPredicted FunctionEffect of MutationSuggested Experimental Approach
Conserved acidic residues in transmembrane helicesProton binding and transferMay abolish or reduce proton pumpingSite-directed mutagenesis to alanine followed by proton pumping assays
Conserved polar residues forming hydrogen bondsStabilization of water molecules in proton wireMay disrupt proton relay networkMutation to hydrophobic residues followed by activity assays
Residues at subunit interfacesContribute to ion channel formation between subunitsMay alter channel dimensionsCrosslinking studies followed by functional assays
Residues facing the lipid bilayerInfluence protein-lipid interactions and stabilityMay affect complex assemblySystematic alanine scanning with thermal stability measurements

These predictions are based on the general principles of proton pumping mechanisms and the limited structural information available for Pa-NQR . Experimental validation is essential to confirm the actual roles of these residues.

How might engineering recombinant nqrD variants help develop new antimicrobial strategies against P. aeruginosa?

The essential role of the NQR complex in P. aeruginosa metabolism and its unique properties compared to human respiratory complexes make it a promising target for antimicrobial development.

Researchers should focus on: (1) High-throughput screening of compound libraries against purified NQR containing wild-type or recombinant nqrD to identify selective inhibitors. (2) Structure-based drug design targeting the unique features of the proton channel in which nqrD participates. (3) Development of peptide inhibitors that disrupt the interaction between nqrD and other subunits, preventing complex assembly. (4) Creating attenuated P. aeruginosa strains with modified nqrD for potential vaccine development. (5) CRISPR-based antimicrobials targeting the nqrD gene. Success in these approaches would be particularly valuable given the rising antibiotic resistance in P. aeruginosa infections .

What role might nqrD play in the adaptation of P. aeruginosa to different host environments during infection?

The unique proton-pumping ability of Pa-NQR suggests potential adaptations to specific ecological niches or host environments.

Future research should investigate: (1) Expression levels of nqrD in clinical isolates from different infection sites (respiratory, urinary, wound) compared to environmental strains. (2) Changes in nqrD expression during different stages of infection, biofilm formation, and under antibiotic stress. (3) The relative contribution of NQR to energy metabolism in environments with different pH, sodium concentrations, and oxygen availability. (4) The potential role of NQR-dependent proton gradients in antibiotic resistance mechanisms, particularly those involving proton-dependent efflux pumps. (5) How nqrD mutations might affect P. aeruginosa fitness in various host niches. Understanding these adaptations could reveal new vulnerabilities to target in this opportunistic pathogen .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.