Recombinant Pseudomonas aeruginosa Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Role

Recombinant Pseudomonas aeruginosa Na⁺-translocating NADH-quinone reductase subunit E (nqrE) is a recombinant protein component of the Na⁺-translocating NADH:quinone oxidoreductase (NQR) complex. This complex functions in bacterial respiratory chains to couple NADH oxidation to sodium (or proton) translocation, generating electrochemical gradients for ATP synthesis and other energy-dependent processes .

Key Features:

  • Subunit Composition: The NQR complex comprises six subunits (A, B, C, D, E, F), with nqrE being a membrane-bound component critical for electron transfer and ion translocation .

  • Ion Selectivity: Unlike homologous NQR complexes in Vibrio cholerae (sodium-pumping), Pseudomonas aeruginosa NQR (Pa-NQR) functions as a proton pump, as demonstrated by structural and functional studies .

  • Cofactors: The subunit interacts with redox centers, including Fe-S clusters and flavins, essential for electron shuttling .

Expression and Production

Recombinant Production:

ParameterDetailsSource
Host OrganismExpressed in E. coli with an N-terminal His-tag for purification.
PurityAffinity chromatography (e.g., Ni-NTA) yields >90% pure protein.
StorageLiquid solution with glycerol; stored at -20°C or -80°C.
ActivityPurified Pa-NQR retains proton-pumping activity in liposomal assays.

Challenges:

  • Cofactor Attachment: Flavins (FMNs) in subunits B and C require ApbE (flavin insertase) for covalent binding, though nqrE does not contain FMN .

  • Quinone Binding: Detergent choice (e.g., dodecyl maltoside vs. LDAO) affects ubiquinone retention in purified complexes .

Research Findings and Functional Insights

Physiological Roles:

  • Proton Gradient Generation: Pa-NQR contributes to ATP synthesis under aerobic conditions, particularly in high-salt environments .

  • Iron Metabolism: In V. cholerae, NQR upregulates FeoB (Fe²⁺ transporter), but analogous roles in P. aeruginosa remain under investigation .

  • Virulence Impact: Deletion of NQR in P. aeruginosa enhances biofilm formation and pyocyanin production, suggesting a regulatory link to pathogenesis .

Comparative Analysis:

ParameterPseudomonas aeruginosa NQRVibrio cholerae NQRSource
Ion PumpsProtonSodium
Cofactor Composition2 Fe-S clusters, FAD, FMNs2 Fe-S clusters, FAD, FMNs
ROS ProductionLimitedHigh (via reduced FAD)

Applications in Research and Therapeutic Targets

Research Utility:

  • Structural Studies: Recombinant nqrE aids in resolving NQR complex topology via cryo-EM and X-ray crystallography .

  • Drug Development: Pa-NQR’s proton-pumping activity makes it a target for novel antibiotics, particularly for treating P. aeruginosa infections .

Therapeutic Relevance:

  • Inhibitor Resistance: Pa-NQR shows resistance to 2-n-heptyl-4-hydroxyquinoline N-oxide (HQNO), unlike other NQRs .

  • ROS Modulation: Reduced FAD in NqrF subunits generates superoxide in V. cholerae, but similar mechanisms in P. aeruginosa are less characterized .

Comparative Analysis with Homologous Complexes

Mechanistic Differences:

AspectPseudomonas aeruginosa NQRVibrio cholerae NQRSource
Ion TranslocationProton (H⁺)Sodium (Na⁺)
Electron TransferFe-S-mediatedFe-S and FMN-mediated
Energy ConservationPrimary proton pumpPrimary sodium pump

Evolutionary Implications:
The divergence in ion selectivity between P. aeruginosa and V. cholerae NQRs highlights adaptive specialization to environmental niches (e.g., marine vs. terrestrial/human hosts) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery timelines may vary depending on the purchase method and location. We recommend consulting your local distributors for specific delivery estimates.
Note: Our default shipping method utilizes standard blue ice packs. For dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please inform us if you have a specific tag type in mind. We will prioritize fulfilling your request during production, if possible.
Synonyms
nqrE; PSPA7_2164; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain PA7)
Target Names
nqrE
Target Protein Sequence
MEHYISLFVKAVFVENMALAFFLGMCTFIAISKKVETAIGLGIAVIVVQTITVPANNLIY TYLLKDGALAWAGLPEVDLSFLGLLSYIGVIAAIVQILEMLLDKYVPSLYNALGVFLPLI TVNCAIMAGSLFMVERDYNLAESTVYGVGSGFSWALAIAALAGIREKLKYSDVPEGLQGL GITFITIGLMSLGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol in two sequential reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Na(+)-translocating NADH-quinone reductase (NQR) complex in Pseudomonas aeruginosa?

The NQR complex in P. aeruginosa is a membrane-bound respiratory enzyme composed of six subunits (NqrA-F) that couples the transfer of electrons from NADH to ubiquinone. Unlike NQR homologues from other bacterial species which function as sodium pumps, P. aeruginosa NQR (Pa-NQR) functions uniquely as a proton pump. This complex contains multiple redox cofactors, including FAD, FMN, riboflavin, and iron-sulfur clusters, which facilitate electron transfer through the enzyme . Pa-NQR plays a significant role in the energy metabolism of this opportunistic pathogen, contributing to its metabolic versatility and adaptability in various environments.

What is the role of NqrE within the NQR complex?

NqrE is one of the six subunits (NqrA-F) of the Na(+)-translocating NADH-quinone reductase complex. This subunit, along with NqrD, contains an intramembranous iron center deeply embedded in the membrane-bound portion of the complex . Recent structural studies have revealed that NqrE participates in forming part of the cation exit channel and contains residues involved in coordinating a unique [2Fe-2S] cluster positioned between NqrD and NqrE . This iron-sulfur cluster is critical for electron transfer within the complex and may play a role in determining cation selectivity of the pump. NqrE is therefore essential for both the structural integrity and electron transport function of the entire NQR complex.

How does P. aeruginosa NQR differ from NQR complexes in other bacteria?

P. aeruginosa NQR represents a significant evolutionary adaptation compared to other bacterial NQR complexes:

CharacteristicP. aeruginosa NQROther bacterial NQR (e.g., Vibrio cholerae)
Ion specificityProton pumpSodium pump
HQNO sensitivityResistant (5-10× more resistant)Sensitive
Ubiquinone binding siteModified residues at positions 151 and 155 in NqrBDifferent amino acid composition
Radical formationLacks the neutral radical in riboflavinContains a stable neutral flavin radical
Ion channelsDistinct exit channel structureDifferent channel architecture

These differences suggest that Pa-NQR has evolved specific adaptations to function in P. aeruginosa's unique physiological context, particularly its resistance to the self-produced inhibitor HQNO, which is secreted during infection and acts as a quorum sensing agent .

What expression systems are most effective for producing recombinant P. aeruginosa NqrE?

For effective expression of recombinant P. aeruginosa NqrE, heterologous expression in E. coli or homologous expression in P. aeruginosa itself have proven successful with the following methodological considerations:

  • Vector selection: The pHERD28T vector system with arabinose-inducible promoters has been successfully used for expressing the complete nqr operon in P. aeruginosa . For E. coli expression, vectors containing T7 promoters with His-tags can be employed.

  • Expression conditions: Optimal expression is achieved by inducing with 0.2% (w/v) arabinose when using arabinose-inducible promoters . Culture conditions typically involve growth at 37°C until mid-log phase, followed by induction and continued growth for 4-6 hours.

  • Codon optimization: When expressing in E. coli, codon optimization may be necessary to account for different codon usage preferences between species.

  • Co-expression considerations: For functional studies, expression of the entire NQR complex (all six subunits) is often preferred over isolated NqrE, as the individual subunit may not fold properly without its interaction partners .

The choice between these systems depends on research goals - E. coli typically yields higher protein quantities but may lack post-translational modifications, while homologous expression in P. aeruginosa better preserves native protein characteristics.

What purification strategy yields the highest purity and activity for recombinant NqrE?

A multi-step purification strategy yields optimal results for recombinant NqrE:

  • Membrane fraction isolation: Harvest cells by centrifugation, disrupt by sonication, and obtain the membrane fraction through ultracentrifugation at approximately 100,000 × g for 1 hour .

  • Detergent solubilization: Solubilize membranes using either dodecyl maltoside (DM) or lauryldimethylamine oxide (LDAO). Note that the choice of detergent significantly affects cofactor retention - DM preserves bound ubiquinone, while LDAO extraction results in negligible quinone content .

  • Affinity chromatography: For His-tagged constructs, use Ni-NTA affinity chromatography with imidazole gradient elution (typically 20-300 mM) .

  • Ion exchange chromatography: Apply DEAE FPLC chromatography as a secondary purification step to remove contaminants and increase purity to approximately 80-95% .

  • Stability considerations: Include glycerol (10-20%) in all buffers to enhance protein stability. Maintain a pH of 7.5-8.0 and include sodium chloride (100-300 mM) throughout purification to preserve structural integrity .

For functional studies, purify the entire NQR complex rather than isolated NqrE, as activity assays typically measure NADH oxidation coupled to ubiquinone reduction, requiring the complete electron transfer chain.

How can the expression yield of recombinant NqrE be optimized?

Optimizing expression yield of recombinant NqrE requires addressing several critical factors:

  • Improved vector design: Incorporate strong ribosome binding sites and optimize the distance between the ribosome binding site and start codon. Inclusion of appropriate signal sequences has been shown to enhance membrane protein expression .

  • Induction optimization: Systematic testing of inducer concentration (0.1-0.5% arabinose for pHERD28T systems), induction timing (mid-log vs. late-log phase), and induction temperature (lower temperatures of 25-30°C often increase yield of properly folded membrane proteins) .

  • Growth media formulation: Supplementing media with iron sources (10-50 μM FeCl₃) can enhance production of iron-containing proteins like NqrE. Studies indicate that complex media such as LB yield higher expression levels compared to minimal media .

  • Genetic modifications: Engineering the expression strain to co-express molecular chaperones can significantly enhance proper folding and yield. Additionally, deletion of specific proteases has been shown to increase recombinant protein stability .

  • Protein stabilization: Inclusion of stability-enhancing mutations identified through computational design approaches similar to those used for PodA enzyme can increase production yields up to 8-fold for membrane proteins .

How can site-directed mutagenesis be employed to study the ion selectivity mechanism of Pa-NQR?

Site-directed mutagenesis provides powerful insights into Pa-NQR's unique ion selectivity through a systematic approach:

  • Target selection based on computational models: Homology modeling and molecular dynamics simulations have identified key residues in the exit ion channels that likely determine cation selectivity between H⁺ and Na⁺ . Focus on conserved charged and polar residues within the predicted transmembrane segments of NqrB, NqrD, and NqrE subunits.

  • Conserved-to-divergent substitution strategy: Replace residues that differ between Pa-NQR (proton-pumping) and Vibrio cholerae NQR (sodium-pumping) to identify determinants of ion specificity. Particular attention should be paid to:

    • Acidic residues (Asp, Glu) potentially forming ion binding sites

    • Conserved histidine residues that may participate in proton relay networks

    • Polar residues (Ser, Thr, Asn, Gln) that could coordinate cations

  • Functional validation: Implement the following assays to evaluate ion selectivity changes:

    • Membrane potential generation in reconstituted proteoliposomes using Oxonol VI as a membrane potential indicator

    • Ion dependence of enzyme activity using different cations (Na⁺, K⁺, Li⁺, etc.)

    • Direct measurement of ion transport using pH-sensitive or Na⁺-sensitive dyes

  • Structural validation: Biophysical techniques including circular dichroism or limited proteolysis should confirm that mutations don't disrupt protein folding or complex assembly.

Recent studies have shown that Pa-NQR forms membrane potential even in the absence of added cations, which is abolished by proton ionophores like CCCP, suggesting that proton pumping is its primary function .

What methods are effective for studying the electron transfer pathway within the NQR complex?

Investigating the electron transfer pathway within the NQR complex requires a multi-technique approach:

  • Transient kinetic spectroscopy: Use stopped-flow and rapid freeze-quench methods coupled with UV-visible spectroscopy to track the sequential reduction of flavin and iron-sulfur cofactors. These methods can resolve electron transfer events occurring on millisecond to second timescales .

  • EPR spectroscopy: Employ electron paramagnetic resonance to detect and characterize paramagnetic species formed during catalysis, particularly the iron-sulfur clusters and flavin semiquinones. X-band EPR (9 GHz) is suitable for initial characterization, while advanced techniques like ENDOR provide detailed electronic structure information .

  • Site-directed mutagenesis of cofactor binding sites: Systematic mutation of residues coordinating the flavins and iron-sulfur clusters allows mapping of the electron transport chain. Key targets include:

    • The FAD binding site in NqrF

    • The [2Fe-2S] cluster ligands in NqrF

    • The covalent FMN attachment sites in NqrB and NqrC

    • The riboflavin binding site in NqrB

    • The iron center in NqrD/E

    • The [2Fe-2S] cluster between NqrD and NqrE

  • Inhibitor studies: Use specific inhibitors like HQNO, which inhibits electron transfer at the quinone binding site. Pa-NQR's resistance to HQNO can be exploited by comparing its electron transfer properties with sensitive NQR variants .

  • Cryo-EM structural analysis: Recent advances in cryo-EM have enabled visualization of conformational changes coupled to different redox states, revealing that the redox state of the intramembranous [2Fe-2S] cluster orchestrates movements of subunit NqrC, which acts as an electron transfer switch .

How can the HQNO resistance mechanism of Pa-NQR be studied and potentially applied to other enzymes?

The HQNO resistance mechanism of Pa-NQR represents a fascinating adaptation that can be studied and potentially transferred to other systems:

  • Structural basis determination:

    • Comparative sequence analysis of NqrB from P. aeruginosa and sensitive species has identified specific residues at positions 151 and 155 that confer resistance

    • Computational modeling and molecular dynamics simulations of the ubiquinone-binding site provide insights into how these residues affect inhibitor binding while maintaining substrate recognition

    • Co-crystallization or cryo-EM studies with bound inhibitors can directly visualize binding mode differences

  • Experimental validation approaches:

    • Site-directed mutagenesis to introduce Pa-NQR residues into sensitive NQR homologs (e.g., V. cholerae NQR) has successfully converted them to HQNO-resistant enzymes

    • Enzyme kinetic studies measuring inhibition constants (Ki) for HQNO with wild-type and mutant enzymes quantify resistance levels

    • Thermal shift assays to assess inhibitor binding through protein stability changes

  • Applications to other enzymes:

    • Transfer of identified resistance determinants to related enzymes in other pathogenic bacteria that are sensitive to quinone-like inhibitors

    • Engineering resistance to natural product inhibitors in biotechnologically relevant enzymes

    • Design of synthetic inhibitors that overcome resistance mechanisms while maintaining antimicrobial activity

  • Broader implications:

    • The resistance mechanism provides insights into how P. aeruginosa adapts to its own secreted compounds, suggesting a role in protection against autotoxicity

    • Understanding HQNO resistance may help develop strategies to overcome P. aeruginosa's intrinsic antibiotic resistance, as HQNO is structurally related to quinolone antibiotics

How does the proton-pumping activity of Pa-NQR differ mechanistically from the sodium-pumping activity of other bacterial NQRs?

The unique proton-pumping activity of Pa-NQR represents a significant adaptation from the sodium-pumping mechanism found in other bacterial NQRs:

  • Structural differences in ion channels:

    • Homology modeling and molecular dynamics simulations suggest that the exit ion channels in Pa-NQR contain specific residues that favor proton selectivity over sodium

    • The architecture of these channels likely determines whether protons or sodium ions are translocated

  • Coupling mechanism:

    • In Na⁺-pumping NQRs (like Vc-NQR), conformational changes in NqrB control the release of Na⁺ from a binding site

    • In Pa-NQR, similar conformational changes may instead facilitate proton translocation through a proton wire mechanism rather than direct ion binding

  • Energy conservation efficiency:

    • Both mechanisms couple electron transfer to ion translocation with a reported 1e⁻/1Na⁺ stoichiometry for sodium-pumping NQR

    • The proton-pumping mechanism of Pa-NQR likely maintains similar efficiency but generates a proton motive force directly, rather than a sodium motive force

  • Experimental evidence:

    • Membrane potential generation studies show that Pa-NQR forms membrane potential even in the absence of added cations

    • This potential is abolished by proton ionophores like CCCP, confirming its proton-pumping nature

    • Pa-NQR can generate membrane potential in the presence of various monovalent cations (Na⁺, K⁺, Rb⁺, Cs⁺, Li⁺), but this is still sensitive to proton ionophores, suggesting all these effects are mediated through proton translocation

  • Evolutionary significance:

    • The shift from sodium to proton pumping represents an adaptation that allows P. aeruginosa to maintain energy production in environments with variable sodium concentrations

    • This adaptation may contribute to P. aeruginosa's remarkable metabolic versatility and ability to colonize diverse niches

How does the NQR complex contribute to P. aeruginosa's remarkable metabolic versatility and antibiotic resistance?

P. aeruginosa's NQR complex plays multifaceted roles in its metabolic versatility and antibiotic resistance:

  • Energetic flexibility in respiratory metabolism:

    • P. aeruginosa uniquely possesses three different NADH dehydrogenases (NQR, NUO, and NDH2), contributing to its metabolic adaptability

    • Even when two of these three enzymes are deleted, P. aeruginosa maintains growth capacity, demonstrating remarkable robustness in energy production

    • During exponential growth phase, these dehydrogenases contribute to total wild-type activity in the order: NQR > NDH2 > NUO, with NQR being the predominant enzyme

  • Adaptation to microaerobic and anaerobic environments:

    • The proton-pumping activity of Pa-NQR allows energy conservation even under conditions where oxygen is limited, such as in biofilms or CF patient lungs

    • This ability to maintain energy production under varied oxygen tensions contributes to persistence in diverse host environments

  • Intrinsic resistance to quinolone-like compounds:

    • Pa-NQR's resistance to HQNO (5-10 times more resistant than other NQR homologues) represents an adaptation to P. aeruginosa's own secreted compounds

    • This resistance mechanism may extend to other quinolone-like molecules, potentially contributing to reduced susceptibility to certain antibiotics

  • Connection to efflux pump activity:

    • The proton motive force generated by NQR can energize efflux pumps that export antibiotics, linking respiratory chain function to antibiotic resistance

    • The MexAB, MexCD, MexEF, and MexXY RND efflux pumps in P. aeruginosa are driven by proton motive force and contribute significantly to multi-drug resistance

  • Metabolic adaptation and virulence factor production:

    • Deletion of NQR increases production of virulence factors like pyocyanin, which itself has redox-cycling properties that can damage host cells and affect the activity of certain antibiotics

    • The metabolic changes resulting from NQR activity or its absence can influence the expression of genes involved in antibiotic resistance and biofilm formation

These characteristics collectively illustrate how NQR contributes to P. aeruginosa's position as a highly adaptable opportunistic pathogen with intrinsic and acquired resistance to multiple antibiotics.

What are the most promising approaches for targeting Pa-NQR in antimicrobial drug development?

Pa-NQR presents several promising avenues for antimicrobial drug development:

  • Rational inhibitor design targeting the unique ubiquinone binding site:

    • Although Pa-NQR is resistant to HQNO, structural and computational analyses of its ubiquinone binding site can guide the design of specific inhibitors that overcome this resistance

    • Structure-based design should focus on the regions in NqrB containing the resistance-conferring residues at positions 151 and 155

    • Virtual screening of compound libraries against this site could identify novel scaffolds with activity against Pa-NQR

  • Targeting the electron transfer pathway:

    • The unique cofactor arrangement in Pa-NQR, including the intramembranous [2Fe-2S] cluster between NqrD and NqrE, presents targets distinct from human respiratory enzymes

    • Inhibitors disrupting electron transfer between these cofactors could selectively inhibit bacterial respiration

  • Exploiting conformational dynamics:

    • Recent structural studies reveal large conformational changes in the NQR complex during catalysis, particularly movements of the NqrC subunit

    • Compounds that lock the enzyme in non-productive conformations could effectively inhibit its function

  • Combination therapy approaches:

    • Inhibitors of Pa-NQR could be developed as adjuvants to existing antibiotics

    • By disrupting energy metabolism, such inhibitors might potentiate the activity of antibiotics that are typically affected by energy-dependent resistance mechanisms like efflux pumps

  • Development considerations and challenges:

    • Membrane protein inhibitors often face challenges with cellular penetration

    • The development pipeline should include screening for compounds that effectively reach their target in P. aeruginosa, which has notoriously impermeable membranes

    • Assays to evaluate target engagement in intact cells will be crucial for advancing compounds through development

Given that NQR is absent in mammalian cells but present in many bacterial pathogens, compounds targeting this complex could offer selective antimicrobial activity with reduced host toxicity concerns.

How can genetic engineering approaches be applied to study or exploit the unique properties of Pa-NQR?

Genetic engineering offers powerful approaches to investigate and utilize Pa-NQR's unique properties:

  • CRISPR-Cas9 genome editing for in vivo studies:

    • Precise modification of the chromosomal nqr operon to introduce point mutations can evaluate the physiological impact of specific residues

    • Creation of clean deletion mutants of individual nqr genes or the entire operon provides insights into their roles in metabolism and virulence

    • Introduction of reporter fusions (e.g., fluorescent proteins) can monitor expression patterns under different growth conditions

  • Synthetic biology applications:

    • Engineering chimeric NQR complexes by swapping domains between proton-pumping (Pa-NQR) and sodium-pumping (Vc-NQR) variants to identify determinants of ion selectivity

    • Creation of simplified minimal NQR variants for structure-function studies

    • Development of NQR-based biosensors that couple respiratory activity to reporter outputs

  • Metabolic engineering strategies:

    • Manipulation of NQR expression levels to alter the energetic efficiency of P. aeruginosa for biotechnological applications

    • Engineering strains with modified respiratory chains optimized for specific bioprocesses

    • Development of attenuated strains with modified NQR activity for potential vaccine applications, similar to approaches used for other P. aeruginosa proteins

  • Methodological considerations:

    • Use of arabinose-inducible promoter systems (pHERD28T) for controlled expression of native or modified NQR complexes

    • Implementation of chromosomal modification techniques using suicide vectors like pKNG101 with sacB-based counterselection

    • Application of tripartite conjugation methods for introducing genetic constructs into P. aeruginosa strains

  • Potential applications in synthetic biology:

    • Development of engineered cells with enhanced energy production capabilities

    • Creation of bacterial chassis with altered ion homeostasis properties

    • Engineering of bacterial cells capable of generating larger electrochemical gradients for bioenergetic applications

These approaches can advance both fundamental understanding of NQR function and potential biotechnological applications of this unique respiratory complex.

What recent structural biology advances have provided new insights into NQR function and mechanism?

Significant structural biology advances have revolutionized our understanding of NQR's function and mechanism:

  • Cryo-EM structures of Na⁺-NQR in different conformational states:

    • Recent structures at 2.5-3.1 Å resolution have revealed the complete arrangement of all six redox cofactors, including a previously unidentified 2Fe-2S cluster located between the NqrD and NqrE subunits

    • These structures have captured different conformational states, providing snapshots of the catalytic cycle

    • The structures reveal that a large part of the hydrophilic NqrF subunit exhibits high flexibility, which may be functionally important for reducing the distance between the 2Fe-2S centers in NqrF and NqrD/E

  • Inhibitor binding studies:

    • Structural analyses have identified that specific inhibitors bind to the N-terminal region of NqrB, which is disordered in the absence of inhibitors

    • These studies provide crucial insights into the structural basis of inhibitor action and resistance mechanisms

  • Conformational dynamics and ion pumping mechanism:

    • The most recent structural work has revealed that ion pumping in Na⁺-NQR is driven by large conformational changes that couple electron transfer to ion translocation

    • The redox state of the unique intramembranous [2Fe-2S] cluster orchestrates movements of subunit NqrC, which acts as an electron transfer switch

    • These movements appear to control the release of Na⁺ from a binding site localized in subunit NqrB, providing the first detailed mechanistic model of ion pumping in this enzyme family

  • Electron transfer pathway mapping:

    • Structural data has revealed that electrons shuttle from NADH twice across the membrane to quinone through the precisely arranged cofactors

    • Edge-to-edge distances between cofactors have been measured, with the FAD in NqrF and 2Fe-2S in NqrF separated by 10.8 Å, almost identical to previously reported crystallographic measurements (9.8 Å)

  • Methodological advances enabling these discoveries:

    • Improvements in cryo-EM technology, particularly the development of direct electron detectors and advanced image processing algorithms

    • Complementary use of X-ray crystallography and cryo-EM to provide comprehensive structural insights

    • Integration of computational approaches including molecular dynamics simulations to understand ion selectivity and conformational changes

These structural advances have transformed our understanding of NQR from a static model to a dynamic machine whose conformational changes drive the coupling of electron transfer to ion pumping.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.