Recombinant Pseudomonas aeruginosa Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Introduction to nqrE

Recombinant nqrE is derived from the nqrE gene of P. aeruginosa strain LESB58 (Uniprot ID: B7UZU1) and is produced via heterologous expression in systems like E. coli, yeast, or mammalian cells . This subunit is part of the NQR complex, a respiratory enzyme that transfers electrons from NADH to ubiquinone while translocating ions across the membrane. Unlike homologous NQR complexes in other bacteria (e.g., Vibrio cholerae), P. aeruginosa NQR exhibits unique functional adaptations, including resistance to endogenous inhibitors like HQNO .

Functional Role in the NQR Complex

The NQR complex in P. aeruginosa has two distinct attributes:

  1. Ion Translocation: While most bacterial NQR complexes pump sodium ions, P. aeruginosa NQR functions as a proton pump . Computational models suggest this specificity arises from differences in the exit ion channels .

  2. HQNO Resistance: HQNO, a quorum-sensing toxin produced by P. aeruginosa, partially inhibits NQR activity. Mutagenesis studies identify residues 151 and 155 in subunit B as critical for resistance, enabling bacterial survival under autotoxic conditions .

Recombinant Production and Purification

Recombinant nqrE is optimized for research applications:

  • Expression: High-yield production in E. coli systems ensures scalability .

  • Purity: Chromatography techniques remove contaminants like nonspecific nucleases .

  • Applications: Used in ELISA, structural studies, and vaccine development .

Enzymatic Activity and Inhibition

  • Catalytic Efficiency: Pa-NQR transfers electrons at rates comparable to sodium-pumping homologues but with altered cofactor dynamics .

  • Inhibitor Studies: Korormicin and aurachin derivatives target the ubiquinone-binding site in homologous NQR complexes, but Pa-NQR’s structural divergence limits their efficacy .

Table 2: Comparative Features of NQR Homologues

FeatureP. aeruginosa NQRV. cholerae NQR
Ion PumpedProton Sodium
HQNO ResistanceHigh (IC₅₀ ~5–10× higher) Low
Subunit Composition6 subunits (monomeric) 6 subunits (homodimeric)

Applications in Biotechnology and Medicine

  1. Antibiotic Development: NQR’s absence in humans makes it a promising target for novel antimicrobials .

  2. Vaccine Research: Recombinant nqrE is used in subunit vaccines to induce immune responses against P. aeruginosa infections .

  3. Enzyme Engineering: Studies on cation selectivity inform the design of bioenergetic tools for synthetic biology .

Challenges and Future Directions

  • Functional Discrepancies: The designation "Na(+)-translocating" in recombinant nqrE conflicts with evidence showing proton-pumping activity in native P. aeruginosa . This may reflect strain-specific variations or historical nomenclature.

  • Structural Resolution: Cryo-EM studies are needed to resolve conformational dynamics during ion translocation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is decided during production. If you have a preferred tag type, please inform us, and we will prioritize developing it for you.
Synonyms
nqrE; PA2995; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
nqrE
Target Protein Sequence
MEHYISLFVKAVFVENMALAFFLGMCTFIAISKKVETAIGLGIAVIVVQTITVPANNLIY TYLLKDGALAWAGLPEVDLSFLGLLSYIGVIAAIVQILEMLLDKYVPSLYNALGVFLPLI TVNCAIMAGSLFMVERDYNLAESTVYGVGSGFSWALAIAALAGIREKLKYSDVPEGLQGL GITFITIGLMSLGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: pae:PA2995

STRING: 208964.PA2995

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NADH-quinone reductase in Pseudomonas aeruginosa?

NADH-quinone reductase (NQR) in Pseudomonas aeruginosa functions as a respiratory enzyme complex that couples the transfer of electrons from NADH to ubiquinone with the pumping of ions across the bacterial cell membrane. Unlike NQR homologues from other bacterial species which function as sodium pumps, P. aeruginosa NQR (Pa-NQR) functions as a proton pump, generating a proton gradient that drives essential cellular processes . This proton-pumping mechanism represents a significant evolutionary adaptation that provides P. aeruginosa with advantages in certain environmental niches.

The electron transfer process occurs in multiple steps:

  • NADH binds to the complex and transfers electrons to FAD

  • Electrons move through the iron-sulfur centers and other cofactors

  • Finally, electrons reduce ubiquinone to ubiquinol

  • During this process, protons are translocated across the membrane

This process contributes to the establishment of the proton motive force that drives ATP synthesis and other energy-dependent processes in the bacterial cell.

How does the structure of the NQR complex incorporate the nqrE subunit?

The NQR complex in P. aeruginosa consists of six subunits (NqrA-F), with nqrE serving as an integral membrane component. Based on homology modeling and molecular dynamics simulations, the nqrE subunit is believed to contribute to the formation of ion channels critical for the proton-pumping activity that distinguishes Pa-NQR from sodium-pumping NQR complexes in other bacteria .

SubunitApproximate Size (kDa)Predicted LocationPrimary Function
NqrA48-50PeripheralNADH binding
NqrB45-48TransmembraneIon translocation
NqrC27-30Membrane-associatedElectron transfer
NqrD22-25TransmembraneIon channel formation
NqrE21-24TransmembraneIon channel/proton pathway
NqrF45-49PeripheralFlavin binding/quinone interaction

The transmembrane domains of nqrE are believed to form critical components of the proton translocation pathway, with specific residues determining cation selectivity in the exit channels .

What expression systems are most effective for recombinant production of P. aeruginosa nqrE?

Several expression systems have been developed for the recombinant production of P. aeruginosa nqrE, each with specific advantages depending on research objectives:

Expression SystemAdvantagesDisadvantagesTypical Yield
E. coli BL21(DE3)High expression levels, well-established protocolsPotential improper folding of membrane proteins1-3 mg/L culture
E. coli C43(DE3)Tolerant to toxic membrane proteinsLower expression levels0.5-1.5 mg/L culture
P. aeruginosa PA01Native environment, proper foldingLower yields, pathogenicity concerns0.2-0.8 mg/L culture
Cell-free systemsAvoids toxicity issues, rapid expressionExpensive, limited scale0.1-0.5 mg/reaction

For functional studies of the assembled complex, co-expression of multiple NQR subunits is often necessary. This typically involves:

  • Construction of multi-cistronic expression vectors

  • Optimization of expression conditions (temperature, induction time, inducer concentration)

  • Careful membrane extraction using appropriate detergents

  • Verification of proper assembly using analytical techniques such as blue native PAGE

What are the most effective purification protocols for recombinant P. aeruginosa nqrE?

Purifying recombinant P. aeruginosa nqrE requires specialized techniques for membrane proteins. Effective purification protocols typically involve:

  • Membrane fraction isolation: Cell disruption by sonication or French press followed by differential centrifugation (10,000 × g to remove cell debris, 100,000 × g to collect membranes)

  • Solubilization: Optimized detergent extraction using:

    • n-dodecyl-β-D-maltoside (DDM): 1-1.5% (w/v) for 1 hour at 4°C

    • Digitonin: 1-2% (w/v) for gentler extraction

    • CHAPS: 1% (w/v) when higher solubilization efficiency is needed

  • Affinity chromatography: Using histidine or streptavidin tags

  • Size exclusion chromatography: For final purification and assessment of oligomeric state

The choice between purifying individual nqrE or the entire NQR complex depends on the research question. For structural studies of the isolated subunit, stronger detergents may be used, while functional studies of the assembled complex require milder conditions to maintain inter-subunit interactions.

How can researchers assess the functional activity of recombinant nqrE in vitro?

Assessing the functional activity of recombinant nqrE requires both isolated subunit analysis and study of its contribution to the assembled NQR complex. Methodological approaches include:

Assay TypeMeasurement ParameterAdvantagesLimitations
NADH oxidationAbsorbance decrease at 340 nmSimple, quantitativeIndirect measure of nqrE function
Ubiquinone reductionAbsorbance change at 275-290 nmDirect measure of electron transferBackground interference
Membrane potentialFluorescence of voltage-sensitive dyesMeasures ion pumpingRequires reconstitution
Proton translocationpH-sensitive indicatorsDirect measure of proton transportTechnical complexity
EPR spectroscopyRedox state of cofactorsDetailed mechanistic insightsSpecialized equipment

For meaningful functional assessment, researchers should compare wild-type nqrE with site-directed mutants to identify residues critical for electron transfer or proton translocation. Control experiments should include specific inhibitors to distinguish NQR activity from other NADH dehydrogenases .

What experimental approaches can elucidate the proton-pumping mechanism of P. aeruginosa NQR?

Understanding the proton-pumping mechanism requires multiple complementary approaches:

  • Site-directed mutagenesis of key residues:

    • Acidic/basic residues in predicted proton channels

    • Conserved residues near cofactor binding sites

    • Residues that differ between Pa-NQR and sodium-pumping NQRs

  • Proton translocation assays:

    • pH-sensitive fluorescent probes in reconstituted proteoliposomes

    • Measurement of H+/e- stoichiometry under varying conditions

    • Response to pH and ion gradients

  • Structural studies:

    • Cryo-electron microscopy of the intact complex

    • X-ray crystallography of individual subunits

    • Hydrogen-deuterium exchange mass spectrometry to identify solvent-accessible regions

  • Computational methods:

    • Molecular dynamics simulations to identify proton pathways

    • Quantum mechanical calculations of proton transfer energetics

    • Homology modeling based on related structures

How does the proton-pumping mechanism of P. aeruginosa NQR differ from sodium-pumping NQR in other bacteria?

P. aeruginosa NQR functions as a proton pump rather than a sodium pump, representing a significant evolutionary adaptation. Key differences include:

FeatureSodium-pumping NQRProton-pumping Pa-NQRSignificance
Ion selectivityNa+ preferredH+ preferredAdaptation to different environments
Exit channelsWider diameterNarrower diameterAccommodates different ion sizes
Key residuesPolar/charged in specific positionsModified residue patternDetermines ion coordination
Energy couplingNADH:Na+ stoichiometry ~1:1NADH:H+ stoichiometry may differReflects energetic considerations
Inhibitor sensitivityTypically sensitive to HQNOResistant to HQNOAdaptation to autotoxicity

Homology modeling and molecular dynamics simulations suggest that these differences are primarily determined by the exit ion channels in the complex . The transition from sodium to proton pumping represents a significant evolutionary adaptation that may provide P. aeruginosa with advantages in certain environmental niches where maintaining a proton gradient is more beneficial than a sodium gradient.

What is the role of nqrE in the resistance of P. aeruginosa NQR to the inhibitor HQNO?

The resistance of P. aeruginosa NQR to HQNO (2-n-heptyl-4-hydroxyquinoline N-oxide) is a significant adaptation, as HQNO is produced by P. aeruginosa itself during infection. This resistance appears to be connected to specific residues in the ubiquinone-binding site, which have been identified through comparative analysis and computational modeling .

While the exact contribution of nqrE to this resistance mechanism isn't fully characterized, it likely involves:

  • Modified binding site: Structural differences in the regions of nqrE that interact with the quinone-binding pocket may prevent HQNO binding while maintaining affinity for the native substrate

  • Altered electron transfer pathway: nqrE may facilitate alternative routes for electron flow that bypass the HQNO-sensitive components

  • Conformational changes: nqrE might induce structural shifts that reduce HQNO binding affinity

This adaptation allows P. aeruginosa to maintain respiratory function even in the presence of self-produced HQNO, providing a selective advantage during infection and biofilm formation where HQNO concentrations can be high .

What are the key cofactors associated with the NQR complex and how are they coordinated?

The NQR complex contains several cofactors that facilitate electron transfer from NADH to ubiquinone:

CofactorLikely LocationFunction in Electron TransferDetection Method
FADNqrF subunitInitial electron acceptor from NADHUV-visible spectroscopy
FMNNqrB, NqrCIntermediate electron carriersFluorescence spectroscopy
Iron-sulfur clustersVarious subunitsElectron transferEPR spectroscopy
UbiquinoneInterface of multiple subunitsTerminal electron acceptorHPLC analysis
RiboflavinNqrBElectron transferFluorescence spectroscopy

The precise arrangement of these cofactors creates an electron transfer pathway with specific redox potentials that ensure directional electron flow. Spectroscopic techniques including EPR (Electron Paramagnetic Resonance) and UV-visible spectroscopy can be used to characterize these cofactors . Site-directed mutagenesis of conserved residues in nqrE that interact with these cofactors can help elucidate their specific roles in the electron transfer process.

How do environmental conditions affect the expression and activity of P. aeruginosa NQR?

The expression and activity of P. aeruginosa NQR are regulated in response to environmental conditions, particularly those relevant to infection scenarios:

Environmental ConditionEffect on NQR ExpressionEffect on NQR ActivityExperimental Approach
Oxygen limitationTypically increasedModified electron flowRNA-seq, qPCR, oxygen electrodes
Biofilm formationCo-regulated with biofilm genesActivity in matrix environmentBiofilm reactors, confocal microscopy
Antibiotic exposureMay be upregulated as stress responsePotential compensatory activityTranscriptomics, respirometry
Host immune factorsComplex regulation patternsModified by immune moleculesInfection models, host-pathogen interfaces
Quorum sensing activationCoordinated with virulenceAdaptation to population densityReporter assays, quorum sensing mutants

Understanding these regulatory patterns requires integrative approaches:

  • Transcriptomic analysis (RNA-seq, qPCR)

  • Proteomic quantification

  • Activity assays under varying conditions

  • Regulatory network reconstruction

The resistance of Pa-NQR to HQNO (a quorum sensing molecule) suggests complex connections between respiratory adaptation and virulence signaling .

What structural features determine the ion selectivity in Pa-NQR compared to sodium-pumping NQRs?

The transition from sodium to proton pumping in Pa-NQR represents a fundamental change in ion selectivity. Key structural determinants may include:

  • Channel dimensions: Proton channels require narrower pathways than sodium channels

  • Protonatable residues: Strategically positioned residues (Asp, Glu, His) that can participate in proton relay systems

  • Hydrophobic gating: Regions that prevent water wire formation except during specific conformational states

  • Conserved water molecules: Structured water that participates in proton transfer

Experimental approaches to study these features include:

  • Site-directed mutagenesis of candidate selectivity residues

  • pH-dependent activity assays

  • Isotope effects using D2O

  • Structural studies comparing Pa-NQR with sodium-pumping NQRs

Homology modeling suggests that the exit ion channels are particularly important in determining ion selectivity .

How does the evolutionary relationship between proton-pumping NQR in P. aeruginosa and sodium-pumping NQR in other bacteria inform our understanding of respiratory adaptation?

The evolutionary transition from sodium-pumping to proton-pumping NQR represents an important adaptation in bacterial respiration. Comparative genomic and phylogenetic analyses suggest:

Evolutionary AspectFindingSignificanceResearch Approach
Ancestral stateSodium-pumping likely ancestralReveals evolutionary directionPhylogenetic analysis
Key mutationsSeveral critical residue changesPotential for engineering ion selectivityAncestral sequence reconstruction
Selection pressuresEnvironmental Na+/H+ availabilityAdaptation to ecological nichesCorrelation with habitat data
Convergent featuresSimilar adaptations in other systemsGeneral principles of ion selectivityComparative analysis

Understanding this evolutionary transition provides insights into bacterial adaptation and the molecular basis of ion selectivity in membrane transporters. The proton-pumping adaptation in P. aeruginosa may reflect its versatility as a pathogen in diverse environments, including the human host where maintaining a proton gradient may offer advantages during infection .

How can structure-based drug design target P. aeruginosa NQR for antimicrobial development?

Structure-based drug design targeting P. aeruginosa NQR represents a promising approach for antimicrobial development, particularly given the rising antibiotic resistance of this pathogen. Methodological approaches include:

  • In silico drug discovery pipeline:

    • Homology modeling of the complete Pa-NQR complex

    • Identification of druggable binding pockets

    • Virtual screening of compound libraries

    • Molecular dynamics simulations to assess binding stability

  • Biochemical validation:

    • Enzyme inhibition assays using purified Pa-NQR

    • Structure-activity relationship studies

    • Resistance development assessment

  • Microbiological evaluation:

    • Growth inhibition assays under varying conditions

    • Biofilm eradication potential

    • Combination effects with existing antibiotics

The unique proton-pumping mechanism of Pa-NQR and its resistance to HQNO provide opportunities for selective targeting that might avoid effects on human enzymes or beneficial microbiota .

What methodological approaches can integrate P. aeruginosa NQR research into systems biology frameworks?

Systems biology approaches offer powerful tools to understand nqrE function within the broader metabolic network of P. aeruginosa:

  • Multi-omics integration:

    • Transcriptomics: RNA-seq to identify co-regulated genes

    • Proteomics: Quantitative analysis of NQR subunits and interacting proteins

    • Metabolomics: Profiling changes in metabolic pathways affected by NQR function

    • Fluxomics: Measuring metabolic flux distributions using isotope labeling

  • Network modeling approaches:

    • Genome-scale metabolic reconstruction incorporating NQR

    • Flux balance analysis to predict phenotypic outcomes

    • Regulatory network inference from multi-omics data

    • Agent-based modeling of bacterial populations

  • Experimental validation methods:

    • CRISPR interference for targeted gene repression

    • Metabolic flux analysis using 13C-labeled substrates

    • High-throughput phenotyping of genetic variants

    • Microfluidic systems for controlled environmental perturbations

These integrative approaches can reveal non-obvious connections between respiratory metabolism and other cellular processes, including virulence factor production, biofilm formation, and antibiotic resistance .

How can advanced experimental design tools improve research on P. aeruginosa NQR?

Advanced experimental design tools can significantly enhance the efficiency and reliability of P. aeruginosa NQR research:

  • Experimental Design Assistant (EDA):

    • Provides a systematic framework for designing in vivo experiments

    • Generates graphical summaries that improve transparency

    • Helps researchers identify variables that could confound outcomes

    • Assists with randomization, blinding, and sample size calculations

  • Statistical power analysis for biochemical experiments:

    • Determining appropriate technical and biological replicates

    • Accounting for variation in enzyme preparations

    • Planning factorial experiments to test multiple conditions efficiently

    • Establishing meaningful effect sizes for inhibitor studies

  • Advanced imaging and spectroscopic approaches:

    • Single-molecule techniques to study conformational dynamics

    • Time-resolved spectroscopy to capture electron transfer events

    • Super-resolution microscopy to visualize membrane organization

    • Correlative microscopy combining functional and structural information

These advanced tools help researchers avoid common pitfalls in experimental design and improve the reliability of results—ultimately leading to more reproducible findings in the challenging field of membrane protein research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.