Recombinant Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit A 1 (nuoA1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudomonas aeruginosa NADH-quinone Oxidoreductase Subunit A 1 (NuoA1)

NADH-quinone oxidoreductase subunit A 1 (NuoA1) is a component of the NADH:ubiquinone oxidoreductase I (NDH-1) enzyme complex found in bacteria such as Pseudomonas aeruginosa . NDH-1, also known as complex I, is an enzyme that catalyzes the transfer of electrons from NADH to quinone, a crucial step in the respiratory chain for energy production .

P. aeruginosa possesses three different enzymes—NUO, NQR, and NDH2—that catalyze the NADH:quinone oxidoreductase step, all of which perform the same function but differ in energy conservation and ion transport properties .

Function and Physiological Role

NuoA1 is a subunit of the NDH-1 complex, which functions as an NADH dehydrogenase, catalyzing the transfer of electrons from NADH to quinone in the cytoplasmic membrane . This process generates a proton electrochemical gradient, integral to both aerobic and anaerobic respiration . The NDH-1 complex is vital for anaerobic respiration, especially when using fumarate or DMSO as terminal electron acceptors, indicating its role in transferring electrons to menaquinone .

Recombinant Production and Characteristics

Recombinant NuoA1 is produced using various hosts such as E. coli, yeast, baculovirus, or mammalian cells . The recombinant protein typically includes a His-tag for purification purposes . Recombinant NuoA1 proteins are available with a purity level greater than or equal to 85%, as determined by SDS-PAGE .

Role in Resistance to Complex I Inhibition

The single-subunit NADH-quinone oxidoreductase can confer resistance against complex I inhibitors in mammalian nerve cells . Expressing Ndi1 protein, a single-subunit NADH dehydrogenase of Saccharomyces cerevisiae, in dopaminergic cell lines makes the cells resistant to complex I inhibitors like rotenone and pyridaben .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted according to your needs.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA1; PSPA7_2570; NADH-quinone oxidoreductase subunit A 1; NADH dehydrogenase I subunit A 1; NDH-1 subunit A 1; NUO1 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain PA7)
Target Names
nuoA1
Target Protein Sequence
MPNPAELAAHHWGFAAFLLGVVGLLAFMLGVSALLGSKAFGRSKNEPFESGIVPTGGARL RLSAKFYLVAMLFVIFDVEALFLFAWSVSVRESGWAGLIEATIFIAILLAGLVYLWRIGA LDWAPESRRKRQAKLKQ
Uniprot No.

Target Background

Function
Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit A1 (NuoA1) facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is believed to be the primary electron acceptor. This process is coupled to proton translocation, with four protons translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of nuoA1 in Pseudomonas aeruginosa's respiratory chain?

NuoA1 is a subunit of the NADH:ubiquinone oxidoreductase (NUO) complex, which is one of three NADH dehydrogenases in P. aeruginosa. This enzyme couples electron transfer from NADH to ubiquinone with proton translocation across the cell membrane. Unlike the NQR complex which was traditionally thought to pump sodium ions, the NUO complex contributes to the proton gradient that drives essential cellular processes like ATP synthesis . NuoA1 specifically is a membrane-embedded subunit that consists of 137 amino acids and plays a structural role in the complex .

How do the three NADH dehydrogenases (NUO, NQR, and NDH2) differ in P. aeruginosa?

P. aeruginosa possesses three distinct NADH dehydrogenases with different energy conservation properties:

NADH DehydrogenaseIon PumpingEnergy ConservationPrimary Role
NUO (Complex I)Proton-pumpingYesRequired for anaerobic growth and virulence
NQRIn P. aeruginosa: proton-pumping (unlike sodium-pumping in other bacteria)YesHighest activity during aerobic growth in rich medium
NDH2No ion pumpingNoBalances NADH/NAD+ ratio to avoid toxic effects of excess NADH

These enzymes contribute to total wild-type NADH dehydrogenase activity in the order: NQR > NDH2 > NUO during exponential growth phase .

What expression systems are optimal for producing recombinant nuoA1?

Recombinant nuoA1 is typically expressed in E. coli expression systems. Based on commercial preparations, the protein is expressed as a full-length construct (1-137 amino acids) with an N-terminal His-tag to facilitate purification . For membrane proteins like nuoA1, it's essential to use expression strategies that accommodate hydrophobic regions. The protein can be isolated at >90% purity using standard SDS-PAGE analysis methods .

How should recombinant nuoA1 be stored and handled to maintain stability?

For optimal stability of recombinant nuoA1:

  • Store the lyophilized powder at -20°C/-80°C upon receipt

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • For buffer conditions, Tris/PBS-based buffer with 6% Trehalose at pH 8.0 is recommended

Repeated freezing and thawing significantly reduces protein stability and should be avoided .

What assays can be used to measure nuoA1 activity as part of the NUO complex?

The activity of the NUO complex (containing nuoA1) can be measured spectrophotometrically by monitoring NADH oxidation. A standard assay includes:

  • Preparation of membrane fractions containing the NUO complex

  • Reaction mixture containing 100 mM NaCl, 50 μM ubiquinone-1 (UQ1), and 25 μg/mL membrane protein

  • Initiation of the reaction by adding 100 μM NADH

  • Monitoring the decrease in NADH absorbance at 340 nm (extinction coefficient = 6.22 mM⁻¹ cm⁻¹)

  • Measuring for approximately 50 seconds after NADH addition

Deamino-NADH (dNADH) can also be used as a substrate in place of NADH to distinguish NUO activity from other NADH dehydrogenases, as it is more selective for NUO .

How can deletion mutants be constructed to study nuoA1 function in P. aeruginosa?

To generate deletion mutants for studying nuoA1 function, researchers have successfully used these approaches:

  • Transposon insertion mutagenesis: Using ISlacZ/hah or ISphoA/hah transposons inserted into the target gene

  • Chromosomal deletion: Using a sacB counter-selectable suicide vector system (e.g., pEX18Gm)

  • Complementation studies: Reintroducing the gene on a plasmid vector (e.g., pHERD28C-his) to verify phenotype recovery

For creating multiple mutations, sequential deletions can be performed in existing mutant backgrounds. This strategy has been used to create both single deletion mutants (each lacking one NADH dehydrogenase) and double deletion mutants (each retaining only one of the three enzymes) .

What is the significance of nuoA1 in adaptation to different oxygen concentrations?

The NUO complex containing nuoA1 appears particularly important for P. aeruginosa adaptation to low oxygen or anaerobic conditions. Research has shown that:

  • NUO is required for anaerobic growth and virulence in certain models

  • P. aeruginosa selectively expresses different respiratory enzymes depending on oxygen availability

  • This respiratory flexibility is crucial for colonization of infection sites, particularly in cystic fibrosis patients' lungs where bacteria face low oxygen availability

  • Strains lacking NUO (Δ nuoG) show altered growth patterns depending on oxygen conditions

Understanding nuoA1's role in this adaptation process may provide insights into P. aeruginosa's success as an opportunistic pathogen in microaerobic environments .

How does nuoA1 contribute to proton translocation in the NUO complex?

As a membrane-embedded subunit of the NUO complex, nuoA1 likely contributes to the proton translocation pathway. Based on computational modeling and related research:

Advanced techniques like molecular dynamics simulations could further reveal how nuoA1 contributes to the proton pumping mechanism .

How does P. aeruginosa nuoA1 differ from homologous proteins in other bacterial species?

Comparative analysis of nuoA1 across different bacterial species reveals:

  • Sequence conservation in the transmembrane regions crucial for complex formation

  • Variations in specific residues that may influence proton translocation efficiency

  • Differences in expression patterns and regulation compared to homologs in other species

The nuoA1 protein in P. aeruginosa is part of a highly adaptable respiratory system that contributes to the organism's metabolic flexibility and pathogenicity. Unlike some other bacterial species where NUO may be the primary NADH dehydrogenase, P. aeruginosa shows a more complex pattern with NQR generally showing higher activity during aerobic growth .

What is the relationship between NUO and virulence in P. aeruginosa compared to other respiratory complexes?

The relationship between the NUO complex (containing nuoA1) and virulence in P. aeruginosa is complex:

  • NUO is required for anaerobic growth and virulence in certain models

  • Interestingly, strains lacking NQR (Δ nqrF) show increased biofilm formation, pyocyanin production, and enhanced killing efficiency in macrophage and mouse infection models

  • Δ nqrF strains show increased transcription of genes involved in pyocyanin production

  • This suggests that NADH metabolism through different dehydrogenases is closely involved in the control of virulence

The presence of three parallel NADH dehydrogenases (NUO, NQR, NDH2) appears to confer resilience on P. aeruginosa's energy production systems rather than representing specialized adaptations to different conditions .

How does the NUO complex (containing nuoA1) contribute to P. aeruginosa pathogenicity?

The NUO complex plays several roles in P. aeruginosa pathogenicity:

  • Enables metabolic flexibility required for colonizing diverse infection sites

  • Contributes to growth under the oxygen-limited conditions found in biofilms and infected tissues

  • Interacts with virulence regulation pathways that control factors like pyocyanin production

  • May influence antibiotic resistance through effects on membrane potential and energy metabolism

P. aeruginosa's respiratory chain is central to its pathogenicity but remains incompletely understood. The organism's ability to thrive in hospital settings and cause serious infections in immunocompromised patients is linked to its metabolic adaptability, to which the NUO complex contributes .

Could the NUO complex be a potential drug target for treating P. aeruginosa infections?

The NUO complex represents a potential drug target for several reasons:

  • It plays an important role in respiratory flexibility and adaptation to different environments

  • Single deletion mutants can still grow, but with altered virulence properties, suggesting targeting NUO may attenuate pathogenicity rather than being directly bactericidal

  • The complex is sufficiently different from human NADH dehydrogenase to allow selective targeting

  • P. aeruginosa infections are increasingly difficult to treat due to antibiotic resistance, necessitating novel targets

How does inhibitor resistance differ between the three NADH dehydrogenases in P. aeruginosa?

The three NADH dehydrogenases in P. aeruginosa show different inhibitor sensitivity profiles:

  • NQR is highly resistant to 2-n-heptyl-4-hydroxyquinoline N-oxide (HQNO), a quorum sensing agent produced by P. aeruginosa itself that has bactericidal properties against other bacteria

  • NQR from P. aeruginosa is 5-10 times more resistant to HQNO compared to NQR homologs from other bacterial species

  • This resistance is due to specific sequence differences in the ubiquinone-binding site

  • The NUO complex generally shows different inhibitor sensitivity profiles compared to NQR and NDH2

This inhibitor resistance profile likely contributes to P. aeruginosa's ability to survive in the presence of its own toxins and possibly antimicrobial agents targeting respiratory complexes .

What experimental approaches would best elucidate the structure-function relationship of nuoA1?

To better understand the structure-function relationship of nuoA1, researchers could employ:

  • Cryo-electron microscopy (cryo-EM) to determine the high-resolution structure of the entire NUO complex with nuoA1 in its native environment

  • Site-directed mutagenesis of conserved residues in nuoA1 to identify those critical for assembly and function

  • Cross-linking studies to map interactions between nuoA1 and other subunits of the NUO complex

  • Computational approaches like molecular dynamics simulations to model proton translocation pathways

  • Proteoliposome reconstitution assays to measure proton pumping activity with various nuoA1 mutants

These approaches would provide complementary information about how nuoA1 contributes to the structure and function of the NUO complex.

How might environmental conditions affect the expression and function of nuoA1 in clinical isolates?

Understanding how environmental conditions affect nuoA1 expression and function in clinical isolates would require:

  • Transcriptomic analysis of clinical isolates grown under various conditions (oxygen levels, nutrient availability, presence of antibiotics)

  • Comparison of nuoA1 sequence variants across clinical isolates from different infection sites

  • Functional assays to determine if nuoA1 variants show altered activity or inhibitor resistance

  • In vitro evolution experiments to identify adaptations in nuoA1 under selective pressures

  • Analysis of biofilm formation and virulence factor production in relation to nuoA1 expression levels

Such studies would provide insights into how P. aeruginosa adapts its respiratory machinery during infection and could identify potential vulnerabilities for therapeutic targeting.

What role might the NUO complex play in antibiotic tolerance and persister cell formation?

Investigating the relationship between the NUO complex and antibiotic tolerance would involve:

  • Comparing antibiotic tolerance profiles between wild-type and NUO-deficient strains

  • Measuring ATP levels and membrane potential in persister cells with and without functional NUO

  • Assessing the effects of metabolic modulators that target NADH dehydrogenase activity on persister formation

  • Analyzing the temporal dynamics of NUO complex activity during transition to persister state

  • Determining whether combined targeting of multiple NADH dehydrogenases increases antibiotic efficacy against persistent infections

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.