Recombinant Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit A 2 (nuoA2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudomonas aeruginosa NADH-Quinone Oxidoreductase Subunit A2 (NuoA2)

Pseudomonas aeruginosa is a highly adaptable opportunistic pathogen with a complex respiratory chain . This bacterium possesses multiple NADH dehydrogenases, including NUO (NADH: ubiquinone oxidoreductase), NQR (sodium regulated, proton pumping NADH dehydrogenase), and NDH-2 (type II NADH:quinone oxidoreductases) . These enzymes catalyze the same redox reaction by accepting electrons from NADH and passing them to the quinone pool, but they differ in their ion pumping and energy conservation properties . The subunit A2 (NuoA2) is part of the NDH-1 complex, encoded by the nuoA-N operon, and is homologous to the mitochondrial complex I .

Function and Significance

Type II NAD(P)H:quinone oxidoreductases (NDH-2) catalyze the two-electron transfer from NAD(P)H to quinones without any energy-transducing site, regenerating NAD(P)+ . NDH-2 enzymes are single polypeptides with molecular masses around 50 kDa and are resistant to complex I-specific inhibitors like piericidin A, capsaicin, and rotenone .

NDH-2 contributes indirectly to the establishment of the transmembrane difference of electrochemical potential by catalyzing the reduction of quinone by oxidation of NAD(P)H . Conserved sequence motifs and structural elements among NDH-2s indicate their structural/functional importance .

Catalytic Mechanism

NDH-2 enzymes employ a catalytic mechanism involving the transfer of two protons to the quinone . A conserved glutamate residue, E172, plays a crucial role in proton transfer to the quinone pocket . The quinone can be reduced directly by hydride transfer from FADH2, needing only a second proton, or the quinone reduction and protonation events can occur separately .

The reaction pathway in NDH-2 can follow either a ternary-complex mechanism (as with NADH) or a ping-pong mechanism (as with NADPH), with the route determined by the affinity of the oxidized nucleotide for the reduced flavin and its rate of dissociation .

Role in Pseudomonas aeruginosa Metabolism and Virulence

P. aeruginosa has three different NADH dehydrogenases: NUO, NQR, and NDH2, which carry out the same redox function but have different energy conservation and ion transport properties . NDH-1 and NDH-2 show redundancy under aerobic conditions, while NDH-1 is required for robust growth under anaerobic conditions .

NDH-1 is essential for anaerobic growth and mutations within the nuo operon are associated with aminoglycoside resistance . The deletion of NDH-1/NDH-2 causes a severe growth defect under both aerobic and anaerobic conditions and was avirulent in a lettuce model .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
nuoA2; PA2637; NADH-quinone oxidoreductase subunit A 2; NADH dehydrogenase I subunit A 2; NDH-1 subunit A 2; NUO1 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
nuoA2
Target Protein Sequence
MPNPAELAAHHWGFAAFLLGVVGLLAFMLGVSSLLGSKAFGRSKNEPFESGIVPTGGARL RLSAKFYLVAMLFVIFDVEALFLFAWSVSVRESGWAGLIEATIFIAILLAGLVYLWRIGA LDWAPESRRKRQAKLKQ
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) clusters, to quinones within the respiratory chain. In this organism, ubiquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy in a proton gradient.

Database Links

KEGG: pae:PA2637

STRING: 208964.PA2637

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit A 2 (nuoA2) in Pseudomonas aeruginosa?

NuoA2 is a membrane-associated subunit of the NADH:ubiquinone oxidoreductase (NUO) complex in Pseudomonas aeruginosa. This complex is one of three NADH dehydrogenases present in P. aeruginosa, alongside the Na⁺-pumping NADH:quinone oxidoreductase (NQR) and the non-proton-pumping NADH dehydrogenase (NDH2) . The NUO complex, also known as Complex I, couples the transfer of electrons from NADH to quinones with proton translocation across the bacterial membrane, thereby contributing to the electrochemical gradient used for ATP synthesis. NuoA2 is specifically involved in the membrane domain of the complex, which is responsible for proton translocation. The "2" designation indicates that it is a second form of the subunit that may have evolved distinct properties compared to traditional nuoA subunits found in other bacteria .

How does the NUO complex differ functionally from other NADH dehydrogenases in P. aeruginosa?

P. aeruginosa possesses three distinct NADH dehydrogenases with varying properties:

EnzymeEnergy ConservationIon TranslocationAdditional FunctionsRelative Efficiency
NUOYesH⁺ pumpingContributes to PMFHighest energy yield
NQRYesNa⁺ pumpingSodium gradient formationModerate energy yield
NDH2NoNoneNADH/NAD⁺ balancingNo energy conservation

The NUO complex differs from NQR in that it pumps protons rather than sodium ions across the membrane. Unlike NDH2, both NUO and NQR conserve energy through ion translocation . Studies with P. aeruginosa mutants have shown that these three enzymes provide redundancy and resilience to the bacterial respiratory chain, allowing the organism to thrive under diverse environmental conditions . This adaptability likely contributes to P. aeruginosa's success as an opportunistic pathogen. Interestingly, deletion studies have revealed that strains lacking NQR show altered production of virulence factors such as pyocyanin, suggesting a link between respiratory chain components and virulence regulation .

What are effective protocols for expressing and purifying recombinant nuoA2?

Expressing and purifying recombinant nuoA2 presents several challenges due to its membrane-associated nature. An effective experimental protocol typically involves:

  • Cloning strategy: The nuoA2 gene should be amplified from P. aeruginosa genomic DNA using high-fidelity polymerase and specific primers containing appropriate restriction sites. For optimal expression, it should be cloned into a vector with a strong inducible promoter (such as pET systems) and a purification tag (His6 or GST) .

  • Expression conditions: Expression in E. coli strains such as BL21(DE3) or C43(DE3) (specially designed for membrane proteins) yields better results. Culture conditions should be optimized as follows:

    • Growth temperature: 18-25°C after induction

    • Inducer concentration: 0.1-0.5 mM IPTG

    • Duration: 16-18 hours

    • Media: Terrific Broth or auto-induction media supplemented with appropriate antibiotics

  • Membrane extraction and solubilization: Cells should be disrupted by sonication or high-pressure homogenization in buffer containing protease inhibitors. Membrane fractions are collected by ultracentrifugation and solubilized using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin .

  • Purification steps:

    • Immobilized metal affinity chromatography (IMAC)

    • Size exclusion chromatography (SEC)

    • Optional ion exchange chromatography for higher purity

This methodological approach, following standard experimental design principles, ensures isolation of functional recombinant nuoA2 suitable for subsequent biochemical and structural studies .

How can researchers verify the functionality of purified recombinant nuoA2?

Verifying the functionality of purified recombinant nuoA2 requires multiple complementary approaches:

  • Enzyme activity assays: Since nuoA2 is part of the larger NUO complex, direct activity measurement of the isolated subunit is challenging. Researchers should consider reconstitution experiments where purified nuoA2 is added to membrane preparations from a nuoA2-deletion mutant to restore NADH:quinone oxidoreductase activity. Activity can be measured by:

    • Monitoring NADH oxidation spectrophotometrically at 340 nm

    • Measuring quinone reduction using appropriate electron acceptors

    • Assessing proton pumping activity in reconstituted proteoliposomes

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm proper secondary structure

    • Thermal shift assays to evaluate protein stability

    • Limited proteolysis patterns compared to native protein

  • Interaction studies:

    • Pull-down assays with other NUO complex subunits

    • Surface plasmon resonance (SPR) to quantify binding affinities

    • Cross-linking followed by mass spectrometry to identify interaction partners

These methodologies collectively provide complementary evidence for proper folding and functional capacity of the purified recombinant nuoA2 protein .

How does the function of nuoA2 relate to P. aeruginosa virulence and pathogenicity?

Research indicates a complex relationship between NADH dehydrogenase activity and P. aeruginosa virulence. Evidence suggests several mechanisms through which nuoA2 and the NUO complex influence pathogenicity:

  • Energy provision for virulence factor production: The proton-pumping activity of the NUO complex generates energy needed for the synthesis and secretion of numerous virulence factors. Studies with mutants lacking various respiratory chain components have revealed altered production of virulence factors like pyocyanin .

  • Redox balance and virulence regulation: NADH metabolism appears closely connected to virulence regulation in P. aeruginosa. Mutants lacking one of the NADH dehydrogenases (particularly NQR) show significantly increased production of pyocyanin and enhanced killing efficiency in macrophage and mouse models .

  • Adaptation to host environments: The presence of three parallel NADH dehydrogenases (including NUO) provides metabolic flexibility that allows P. aeruginosa to adapt to diverse microenvironments encountered during infection, including oxygen-limited conditions and varying pH and ion concentrations .

  • Resistance to host defense mechanisms: Proper respiratory chain function helps P. aeruginosa withstand oxidative stress encountered during host immune responses. The NUO complex contributes to this resistance by maintaining appropriate NADH/NAD+ ratios .

The connection between respiratory chain components and virulence represents a potential avenue for therapeutic intervention, as targeting nuoA2 or other NUO subunits might attenuate virulence without directly killing the bacteria, potentially reducing selection pressure for resistance .

What experimental approaches can determine the structural features of nuoA2?

Elucidating the structural features of nuoA2 requires sophisticated experimental approaches, particularly due to its membrane-associated nature:

  • X-ray crystallography: Although challenging with membrane proteins, this approach can provide high-resolution structural information. Success requires:

    • Extensive screening of crystallization conditions

    • Use of lipidic cubic phase crystallization methods

    • Addition of stabilizing antibody fragments or nanobodies

    • Incorporation of suitable detergents and lipids

  • Cryo-electron microscopy (cryo-EM): Increasingly the method of choice for membrane protein complexes, as it:

    • Requires less protein material than crystallography

    • Can capture different conformational states

    • Works well for larger assemblies like the complete NUO complex

    • Avoids the need for crystal formation

  • NMR spectroscopy: Most applicable to specific domains or fragments of nuoA2:

    • Solution NMR for soluble domains

    • Solid-state NMR for membrane-spanning regions

    • Selective isotope labeling to focus on specific residues

  • Computational approaches:

    • Homology modeling based on related structures

    • Molecular dynamics simulations to predict functional movements

    • Coevolutionary analysis to identify interacting surfaces

A comprehensive structural characterization typically requires integration of multiple techniques, with complementary information from biochemical experiments such as cross-linking and mutagenesis studies to validate the structural models .

How can researchers reconcile contradictory results in nuoA2 function studies?

Resolving contradictions in nuoA2 functional studies requires systematic analysis of experimental variables and careful data interpretation:

  • Strain variation analysis: Different P. aeruginosa strains can exhibit distinct phenotypes even with identical genetic modifications. Researchers should:

    • Document complete strain lineages

    • Sequence verify all genetic modifications

    • Compare phenotypes across multiple reference strains

    • Create isogenic mutants to eliminate background effects

  • Methodological standardization:

    • Establish consistent growth conditions (media, temperature, aeration)

    • Standardize protein expression and purification protocols

    • Use multiple complementary activity assays

    • Implement robust statistical analysis with appropriate sample sizes

  • Context-dependent function assessment: The function of nuoA2 may vary depending on:

    • Growth phase (exponential vs. stationary)

    • Environmental conditions (oxygen availability, pH, ion concentrations)

    • Presence of other respiratory chain components

    • Metabolic state of the bacteria

  • Data integration approaches:

    • Meta-analysis of published studies

    • Collaborative cross-laboratory validation

    • Systems biology modeling to contextualize contradictory observations

When analyzing seemingly contradictory results, researchers should consider that the three NADH dehydrogenases in P. aeruginosa appear to have partly overlapping functions that provide metabolic resilience. This redundancy can mask phenotypes in single gene knockout studies and contribute to apparently contradictory observations .

What bioinformatic approaches aid in understanding nuoA2 evolution and function?

Modern bioinformatic tools offer powerful means to investigate nuoA2 evolution and function:

  • Sequence-based analyses:

    • Multiple sequence alignment across diverse bacterial species to identify conserved residues

    • Phylogenetic analysis to track evolutionary history

    • Selection pressure analysis (dN/dS ratios) to identify functionally important regions

    • Prediction of transmembrane domains and functional motifs

  • Structural bioinformatics:

    • Homology modeling based on related proteins with known structures

    • Molecular dynamics simulations to predict conformational changes

    • Protein-protein interaction surface prediction

    • Electrostatic surface mapping to identify potential proton channels

  • Systems biology approaches:

    • Gene neighborhood analysis to identify functionally related genes

    • Transcriptomic data integration to understand expression patterns

    • Protein-protein interaction network analysis

    • Metabolic flux analysis to predict the impact of nuoA2 alterations

  • Comparative genomics:

    FeatureP. aeruginosaE. coliM. tuberculosis
    NUO subunits14 subunits14 subunits14 subunits
    nuoA2 presenceYesNoNo
    Alternative NADH dehydrogenasesNQR, NDH2NDH2NDH2
    Genomic contextRespiratory flexibilityPrimarily aerobicAdaptable to hypoxia

These bioinformatic approaches, when integrated with experimental data, provide a comprehensive understanding of nuoA2's role and evolution within the context of bacterial energy metabolism .

How might understanding nuoA2 function contribute to novel antimicrobial strategies?

The potential for nuoA2-based antimicrobial strategies stems from several key aspects of its function and importance:

  • Targeted inhibition approaches:

    • Developing small molecule inhibitors specific to P. aeruginosa nuoA2

    • Creating peptide-based inhibitors that disrupt subunit assembly

    • Designing allosteric modulators that alter enzyme efficiency

    • Exploring combination therapies targeting multiple respiratory chain components

  • Virulence attenuation strategies:

    • Modulating NADH dehydrogenase activity to disrupt virulence factor production

    • Altering redox signaling pathways that control toxin expression

    • Creating metabolic bottlenecks that reduce pathogenic potential without directly killing bacteria

    • Developing anti-virulence compounds that don't exert strong selective pressure

  • Immune response enhancement:

    • Using nuoA2-derived peptides as vaccine components

    • Creating attenuated strains with modified nuoA2 for immunization

    • Developing antibody therapies targeting surface-exposed portions of the NUO complex

    • Enhancing host recognition of P. aeruginosa by modifying its metabolic signature

  • Diagnostic applications:

    • Developing rapid detection methods targeting nuoA2 or its expression products

    • Creating biosensors that detect specific NUO activity signatures

    • Establishing metabolic profiling approaches to identify P. aeruginosa infections

    • Implementing CRISPR-Cas12a-based detection systems for specific identification

Given the rising antimicrobial resistance in P. aeruginosa, these alternative approaches targeting nuoA2 could provide valuable new therapeutic options that circumvent traditional resistance mechanisms .

What methodological advances would enhance nuoA2 research?

Advancing nuoA2 research requires innovative methodological approaches across multiple disciplines:

  • Structural biology enhancements:

    • Implementation of microcrystal electron diffraction (MicroED) for membrane proteins

    • Application of advanced cryo-EM techniques including time-resolved cryo-EM

    • Development of native mass spectrometry approaches for intact membrane complexes

    • Integration of hydrogen-deuterium exchange mass spectrometry for dynamic analyses

  • Functional assessment innovations:

    • Single-molecule enzymology to capture heterogeneous behavior

    • Development of fluorescent probes specific for NUO activity

    • Implementation of microfluidic systems for rapid enzyme kinetics

    • Application of electrochemical methods to study electron transfer dynamics

  • Genetic manipulation advances:

    • CRISPR-Cas9 precise genome editing to create subtle nuoA2 variants

    • Inducible expression systems for temporal control of nuoA2 function

    • Single-cell analysis techniques to study population heterogeneity

    • Development of in vivo reporters for respiratory chain activity

  • Computational method improvements:

    • Enhanced molecular dynamics simulations incorporating lipid environments

    • Machine learning approaches for predicting protein-protein interactions

    • Quantum mechanical calculations of electron transfer pathways

    • Systems biology models integrating metabolomics and transcriptomics data

These methodological advances would collectively enhance our understanding of nuoA2 structure, function, and potential as a therapeutic target, while providing new tools for studying membrane proteins more broadly .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.