Recombinant Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit J (nuoJ)

Shipped with Ice Packs
In Stock

Description

Overview of NADH-Quinone Oxidoreductase Subunit J (nuoJ)

NADH-quinone oxidoreductase subunit J (nuoJ) is a critical component of the respiratory chain in Pseudomonas aeruginosa, a Gram-negative pathogen associated with nosocomial infections. This subunit forms part of the NQR (NADH:ubiquinone oxidoreductase) complex, which facilitates electron transfer from NADH to ubiquinone while coupling this process to ion translocation across the bacterial membrane . Unlike homologs in other bacteria, P. aeruginosa NQR functions as a proton pump rather than a sodium pump, a unique adaptation linked to its survival in diverse environments .

Proton-Pumping Activity

Unlike sodium-pumping NQR complexes in Vibrio cholerae, P. aeruginosa NQR (Pa-NQR) generates a proton gradient, which powers ATP synthesis and other cellular processes . Molecular dynamics simulations attribute this cation specificity to differences in ion channel architecture .

Resistance to HQNO

Pa-NQR exhibits partial resistance to 2-n-heptyl-4-hydroxyquinoline N-oxide (HQNO), a quorum-sensing molecule produced by P. aeruginosa. Mutational analysis identified residues in the ubiquinone-binding site (e.g., positions 151 and 155 in subunit B) that confer resistance while maintaining enzymatic activity .

Anaerobic Growth Defects

Deletion of nuoIJ disrupts anaerobic growth in nitrate-rich environments, highlighting its role in alternative respiratory pathways . Strains lacking nuoIJ also exhibit delayed entry into exponential growth phases under aerobic conditions .

Antibiotic Resistance

AntibioticWild-Type MICΔnuoIJ MICFold Change
Gentamicin0.4 mg/L1.2 mg/L3x
Kanamycin12.5 mg/L25 mg/L2x

ΔnuoIJ mutants show increased resistance to aminoglycosides, likely due to reduced proton motive force (PMF) required for drug uptake .

Comparative Analysis with Other NADH Dehydrogenases

P. aeruginosa expresses three NADH dehydrogenases with distinct properties:

EnzymeIon TransportEnergy ConservationRole in Virulence
NUOProtonHighRequired for full virulence
NQRProtonModerateHQNO resistance
NDH-2NoneNoneRedox balance in ΔNUO/NQR

NUO and NQR are functionally redundant in vivo, but NUO is indispensable under anaerobic conditions .

Implications for Pathogenicity and Antimicrobial Strategies

  • Biofilm Formation: ΔnqrF (NQR-deficient) strains overproduce pyocyanin and biofilms, enhancing persistence in host tissues .

  • Virulence: NUO-deficient strains exhibit delayed lethality in Galleria mellonella and lettuce models, while NQR deletion increases macrophage cytotoxicity .

  • Therapeutic Targets: HQNO resistance in Pa-NQR suggests evolutionary adaptations to self-produced toxins, offering insights into inhibitor design .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoJ; PA2645; NADH-quinone oxidoreductase subunit J; NADH dehydrogenase I subunit J; NDH-1 subunit J
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
nuoJ
Target Protein Sequence
MEFAFYFAAGVAVLATLRVITNSNPVHALLYLIISLLAISMTFFSLGAPFAGALEIIVYA GAIMVLFVFVVMMLNLGPAVVEQERKWLTPGIWVGPSALALVLLVELLVVLARTPSGAGI GHTTVDAKAVGISLYGPYLLVVELASMLLLAALVAAYHLGRQDAKQ
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be ubiquinone. It couples the redox reaction with proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), thereby conserving the redox energy in a proton gradient.
Database Links

KEGG: pae:PA2645

STRING: 208964.PA2645

Protein Families
Complex I subunit 6 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit J (nuoJ) in Pseudomonas aeruginosa?

NADH-quinone oxidoreductase subunit J (nuoJ) is a protein component of the NADH:ubiquinone oxidoreductase (NUO) complex in Pseudomonas aeruginosa. This protein is one of the subunits that make up Complex I of the respiratory chain. The nuoJ protein consists of 166 amino acids and functions as part of the membrane domain of the NUO complex. The protein is characterized by a predominantly hydrophobic profile, which facilitates its integration into the bacterial cell membrane. NuoJ works in concert with other NUO subunits to catalyze electron transfer from NADH to ubiquinone, which is a critical step in cellular respiration and energy production in P. aeruginosa .

What are the three NADH dehydrogenases in Pseudomonas aeruginosa and how do they differ?

Pseudomonas aeruginosa possesses three distinct NADH dehydrogenases that catalyze the same redox function but differ in their energy conservation and ion transport properties:

NADH DehydrogenaseFull NameKey CharacteristicsIon Transport
NUONADH:ubiquinone oxidoreductaseComplex, multi-subunit enzyme (including nuoJ)Proton pump
NQRNADH:quinone oxidoreductaseUnique to certain bacteriaProton pump in P. aeruginosa (differs from sodium pump in other species)
NDH2Type II NADH dehydrogenaseSimpler structureNon-pumping

How is recombinant nuoJ typically prepared for research applications?

Recombinant Pseudomonas aeruginosa nuoJ can be prepared using several approaches:

  • Expression system: The most common approach is expression in E. coli using a plasmid vector with an appropriate promoter and affinity tag. The nuoJ gene (PA2645) is cloned into an expression vector with an N-terminal His-tag to facilitate purification .

  • Protein extraction and purification:

    • Cell lysis using mechanical disruption or detergent-based methods

    • Membrane fraction isolation through differential centrifugation

    • Solubilization of membrane proteins using appropriate detergents

    • Affinity chromatography using the His-tag

    • Further purification steps may include ion exchange or size exclusion chromatography

  • Storage and handling recommendations:

    • Store purified protein at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

    • For working aliquots, store at 4°C for up to one week

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol is recommended for long-term storage

How can researchers effectively design experiments to study the function of nuoJ within the NUO complex?

Designing effective experiments to study nuoJ function requires a systematic approach:

  • Genetic manipulation strategies:

    • Generation of nuoJ deletion mutants using allelic exchange techniques

    • Creation of site-directed mutants to investigate specific residues

    • Complementation studies with wild-type and mutant versions of nuoJ

    • Construction of double or triple deletion mutants lacking combinations of NUO, NQR, and NDH2 to assess functional redundancy

  • Experimental design considerations:

    • Define clear independent variables (e.g., mutations in nuoJ) and dependent variables (e.g., respiratory activity, growth rate)

    • Include appropriate controls (wild-type strains, vector-only controls)

    • Account for extraneous variables such as growth conditions and media composition

    • Use a between-subjects design comparing different strains under identical conditions

  • Physiological assessment methods:

    • Growth curve analysis under various conditions (rich vs. minimal media, different pH values, varying [Na+])

    • Oxygen consumption measurements

    • Membrane potential measurements using fluorescent probes

    • Assessment of NADH oxidation rates in membrane preparations

  • Molecular dynamics simulations:

    • Homology modeling based on related structures

    • Simulations of ion channels and substrate binding sites

    • Investigation of conformational changes during the catalytic cycle

What are the comparative properties of nuoJ across different bacterial species and what does this reveal about its evolution?

Comparative analysis of nuoJ across bacterial species provides insights into its evolutionary conservation and functional specialization:

Bacterial SpeciesNuoJ FeaturesFunctional Specialization
P. aeruginosa166 amino acids; highly hydrophobicPart of proton-pumping NUO complex
E. coliSimilar size; moderate sequence identityWell-characterized proton pump
Vibrio choleraeHigher sequence divergenceFunctions in sodium-dependent environment
Mycobacterium tuberculosisDistinct sequence variationsAdapted to unique respiratory requirements

Key evolutionary insights:

  • Core structural elements of nuoJ are conserved across diverse bacterial species, reflecting the fundamental importance of this subunit in respiratory function

  • Sequence variations in key regions correlate with differences in ion specificity and environmental adaptations

  • The presence of all three NADH dehydrogenases (NUO, NQR, NDH2) in P. aeruginosa represents an example of functional redundancy that may confer selective advantages in diverse environments

  • Studies of P. aeruginosa NQR have revealed that, unlike NQR homologues from other bacterial species that function as sodium pumps, the P. aeruginosa version functions as a proton pump, demonstrating evolutionary adaptation of these respiratory complexes

What analytical techniques are most effective for studying nuoJ structure-function relationships?

Several sophisticated analytical techniques can be employed to investigate nuoJ structure-function relationships:

  • Structural analysis techniques:

    • X-ray crystallography of the purified NUO complex

    • Cryo-electron microscopy for high-resolution structural determination

    • NMR spectroscopy for dynamic structural information

    • Cross-linking studies to map protein-protein interactions within the complex

  • Functional assays:

    • Enzyme kinetics measurements to determine Vmax and Km values

    • Ion translocation assays using pH-sensitive or ion-sensitive fluorescent probes

    • Potentiometric measurements to assess membrane potential generation

    • Reconstitution of purified components into liposomes to study isolated function

  • Biophysical characterization:

    • Circular dichroism spectroscopy to analyze secondary structure

    • Fluorescence spectroscopy to monitor conformational changes

    • Isothermal titration calorimetry to measure binding affinities

    • Surface plasmon resonance for real-time interaction analysis

  • Computational approaches:

    • Molecular dynamics simulations of nuoJ and the NUO complex

    • Quantum mechanical calculations of electron transfer pathways

    • Bioinformatic analysis of sequence conservation patterns

    • Homology modeling and docking studies to predict interactions

How does the ion specificity of P. aeruginosa NADH dehydrogenases differ from homologues in other bacterial species?

The ion specificity of P. aeruginosa NADH dehydrogenases exhibits unique characteristics compared to homologues in other bacterial species:

  • NQR complex ion specificity:

    • P. aeruginosa NQR functions as a proton pump, unlike NQR homologues from other bacterial species which function as sodium pumps

    • This represents a completely new form of proton pump that evolved from a sodium pump ancestor

    • Homology modeling and molecular dynamics simulations suggest that cation selectivity could be determined by the exit ion channels

  • Structural determinants of ion specificity:

    • Key amino acid residues in the ion channels determine whether H+ or Na+ is transported

    • Mutations in these residues can alter ion specificity

    • The three-dimensional arrangement of transmembrane helices creates pathways for ion translocation

  • Evolutionary implications:

    • The presence of three different NADH dehydrogenases with different ion specificities provides P. aeruginosa with metabolic flexibility

    • This adaptation may contribute to the bacterium's ability to thrive in diverse environments and its success as an opportunistic pathogen

    • The shift from sodium to proton pumping in the NQR complex represents a significant evolutionary adaptation

What are the methodological challenges in purifying and studying membrane-bound nuoJ and how can they be overcome?

Purifying and studying membrane-bound proteins like nuoJ presents several significant challenges:

  • Challenges in protein expression and purification:

    • Low expression levels of membrane proteins

    • Protein misfolding and aggregation

    • Difficulty in extracting proteins from membranes

    • Maintaining protein stability and activity during purification

  • Solutions and methodological approaches:

    • Optimization of expression systems: Use of specialized E. coli strains designed for membrane protein expression, with controlled induction conditions and lower temperatures

    • Effective solubilization: Screening of detergents (DDM, CHAPS, digitonin) for optimal extraction while preserving protein structure

    • Purification strategy: Multi-step purification combining affinity chromatography with size exclusion and ion exchange techniques

    • Stabilization approaches: Addition of lipids or amphipols to maintain native-like environment

  • Reconstitution techniques:

    • Incorporation into nanodiscs or liposomes to recreate membrane environment

    • Use of lipid compositions mimicking the P. aeruginosa membrane

    • Reconstitution of the complete NUO complex to study subunit interactions

  • Storage and handling recommendations:

    • Avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for limited periods

    • Use of glycerol (5-50%) for long-term storage at -20°C/-80°C

    • Reconstitution of lyophilized protein under controlled conditions

What are the emerging techniques that may advance nuoJ research?

Recent technological advances offer new opportunities for nuoJ research:

  • Cryo-EM advancements for high-resolution structural determination of membrane protein complexes without crystallization

  • Native mass spectrometry techniques to study intact membrane protein complexes

  • Single-molecule techniques to observe conformational changes and dynamics during catalysis

  • CRISPR-Cas9 genome editing for precise manipulation of nuoJ in its native context

  • AlphaFold and related AI tools for improved structural prediction of membrane proteins

How does understanding nuoJ contribute to broader research on bacterial bioenergetics and pathogenesis?

Understanding nuoJ has significant implications for multiple research areas:

  • Respiratory flexibility in P. aeruginosa contributes to its success as an opportunistic pathogen

  • Metabolic adaptation mechanisms may inform strategies to combat antibiotic resistance

  • Evolutionary diversification of respiratory complexes reflects bacterial adaptation to different ecological niches

  • Structure-function relationships in membrane protein complexes advance our fundamental understanding of bioenergetic principles

  • Novel antimicrobial targets may emerge from detailed understanding of essential respiratory components

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.