Recombinant Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preference in the order notes and we will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this need to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
nuoK; PSPA7_2560; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain PA7)
Target Names
nuoK
Target Protein Sequence
MNAIPLEHGLALASVLFALGLVGLMVRRNILFVLMSLEVMMNAAALAFVVAGSRWGQPDG QVMFILVLSLAAAEASIGLAILLQLYRRFHTLDIDAASEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this particular species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. This process couples the redox reaction with proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. Consequently, the redox energy is conserved within a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of nuoK in Pseudomonas aeruginosa?

NuoK is part of the nuoA-N operon (PA2637-2649) in P. aeruginosa that encodes the 14 subunits of the NDH-1 complex (also known as NUO). The operon has a unique characteristic in P. aeruginosa, possessing a fused nuoCD subunit rather than separate C and D subunits found in other bacteria . This genomic organization is significant for understanding the evolution and functionality of the respiratory complex in P. aeruginosa compared to other bacterial systems.

How does NuoK differ from components of other NADH dehydrogenases in P. aeruginosa?

P. aeruginosa possesses three distinct NADH dehydrogenases: NDH-1 (containing NuoK), NDH-2, and NQR. While all three catalyze the same redox reaction of transferring electrons from NADH to the quinone pool, they differ fundamentally in structure and function. NuoK is part of the NDH-1 complex, which is homologous to mitochondrial complex I and couples electron transfer to proton translocation. NDH-2 is a simpler enzyme that doesn't pump ions, while NQR is a unique sodium-regulated, proton-pumping complex . NuoK's presence in the membrane-embedded arm of NDH-1 suggests its involvement in the conformational changes necessary for ion translocation.

What are effective strategies for recombinant expression of P. aeruginosa NuoK?

For recombinant expression of P. aeruginosa NuoK, several strategies have shown promise, similar to approaches used for other membrane proteins:

  • Expression Systems:

    • E. coli C41(DE3) or C43(DE3) strains designed for membrane protein expression

    • P. aeruginosa expression systems (homologous expression) using vectors like pHERD28T

    • Cell-free expression systems for toxic membrane proteins

  • Vector Design:

    • Incorporation of histidine tags for purification

    • Use of appropriate promoters (T7, arabinose-inducible)

    • Codon optimization for the expression host

  • Expression Conditions:

    • Induction at lower temperatures (16-20°C)

    • Lower inducer concentrations for gradual expression

    • Supplementation with membrane-stabilizing agents

Standard molecular biology protocols using vectors such as pHERD28T with selective markers (like chloramphenicol resistance) and histidine tags have been successfully used for similar P. aeruginosa membrane proteins .

What purification methods are optimal for maintaining NuoK stability and function?

Purification of membrane proteins like NuoK requires specialized approaches:

  • Membrane Isolation:

    • Differential centrifugation following cell lysis

    • Sucrose gradient purification of membrane fractions

  • Solubilization:

    • Screening of detergents (DDM, LMNG, digitonin)

    • Detergent/lipid mixtures to maintain native-like environment

    • Nanodiscs or SMALPs for maintaining a lipid environment

  • Purification Steps:

    • Immobilized metal affinity chromatography (IMAC)

    • Size exclusion chromatography for removing aggregates

    • Ion exchange chromatography for increasing purity

  • Stability Considerations:

    • Maintaining cold temperatures throughout purification

    • Including appropriate lipids in purification buffers

    • Using stabilizing agents such as glycerol or specific ions

Throughout the process, activity assays should be performed to ensure the functional integrity of the purified protein .

How can one assess the functional integrity of recombinant NuoK?

Assessing NuoK functionality presents challenges as it functions within the larger NDH-1 complex. Approaches include:

  • Complex Assembly Analysis:

    • Blue-native PAGE to verify incorporation into the NDH-1 complex

    • Co-immunoprecipitation with other Nuo subunits

    • Crosslinking studies to confirm proper interactions

  • Functional Assays:

    • NADH oxidation activity of reconstituted complexes

    • Proton pumping assays using pH-sensitive fluorescent dyes

    • Membrane potential measurements in proteoliposomes

  • Biophysical Techniques:

    • Circular dichroism to verify proper secondary structure

    • Fluorescence spectroscopy for tertiary structure

    • Thermal stability assays to assess protein folding

These approaches enable researchers to determine whether recombinant NuoK maintains its native function and structure .

What methods are used to study proton translocation associated with NuoK activity?

Proton translocation studies for NuoK involve:

  • Proteoliposome Reconstitution:

    • Incorporation of purified NDH-1 complex into liposomes

    • Creating an orientation-controlled system to measure directionality

  • Measurement Techniques:

    • pH-sensitive fluorescent dyes (ACMA, pyranine)

    • pH electrode measurements

    • Ion-selective electrodes

  • Control Experiments:

    • Inhibitor studies (rotenone, piericidin A)

    • Ionophore controls (CCCP, valinomycin)

    • Comparison with mutant complexes

  • Data Analysis:

    • Calculation of H+/e- stoichiometry

    • Kinetic analysis of proton translocation rates

    • Comparison with theoretically predicted values

These approaches help elucidate how NuoK contributes to the proton translocation mechanism of the NDH-1 complex .

What structural techniques have been applied to understand NuoK topology?

Understanding NuoK's membrane topology involves:

  • Computational Methods:

    • Hydropathy analysis and transmembrane domain prediction

    • Homology modeling based on resolved bacterial NDH-1 structures

    • Molecular dynamics simulations

  • Experimental Approaches:

    • Cysteine scanning mutagenesis with accessibility reagents

    • Epitope insertion with antibody binding studies

    • Protease accessibility mapping

  • Advanced Structural Techniques:

    • Cryo-electron microscopy of the entire NDH-1 complex

    • X-ray crystallography of purified complexes

    • Cross-linking mass spectrometry for interaction mapping

While specific structural data for P. aeruginosa NuoK is limited, comparative analyses with homologs in other bacteria provide valuable insights into its likely structural organization within the membrane .

What is known about critical residues in NuoK for proton translocation?

Based on studies of homologous systems, several key features are important:

  • Conserved Charged Residues:

    • Glutamate and lysine residues forming part of proton channels

    • Histidine residues potentially serving as proton acceptors/donors

  • Hydrophilic Interruptions:

    • Disruptions in transmembrane helices creating water-accessible cavities

    • Residues forming hydrogen bond networks for proton transfer

  • Conformational Switch Elements:

    • Glycine residues allowing conformational flexibility

    • Proline residues creating kinks in transmembrane helices

  • Interface Residues:

    • Amino acids interacting with other Nuo subunits

    • Residues responding to conformational changes in the peripheral arm

Mutation studies of these residues in model organisms have demonstrated their importance for proton translocation, and similar approaches could be applied to P. aeruginosa NuoK .

How does NuoK contribute to P. aeruginosa virulence and pathogenicity?

The NDH-1 complex containing NuoK plays significant roles in P. aeruginosa pathogenicity:

  • Energetic Support for Virulence:

    • Providing energy through proton motive force generation

    • Supporting ATP synthesis during host infection

  • Adaptation to Host Environments:

    • Contributing to metabolic flexibility in oxygen-limited conditions

    • Supporting growth under varying nutrient availabilities

  • Antibiotic Resistance:

    • Mutations in the nuo operon are associated with aminoglycoside resistance

    • The energy dependence of aminoglycoside uptake is affected by NDH-1 function

  • Virulence Studies:

    • In Galleria mellonella (insect) models, NDH-1 deletion affects killing kinetics

    • In plant models, NDH-1 deletion decreases tissue damage and bacterial recovery

These findings highlight the importance of NDH-1 function, of which NuoK is an integral part, for P. aeruginosa pathogenesis .

What is the role of NuoK in aerobic versus anaerobic metabolism?

NDH-1 (containing NuoK) shows differential importance depending on oxygen availability:

  • Aerobic Conditions:

    • NDH-1 and NDH-2 are largely redundant during aerobic growth

    • Deletion of NDH-1 alone doesn't significantly impair aerobic growth

  • Anaerobic Conditions:

    • NDH-1 is required for robust anaerobic growth

    • Overexpression of NDH-2 can partially rescue NDH-1 deletion under anaerobic conditions

    • No compensatory upregulation of NDH-2 occurs naturally in NDH-1 deletion strains

  • Metabolic Switching:

    • P. aeruginosa doesn't switch between different NADH dehydrogenases under different growth conditions

    • Instead, parallel enzymes provide metabolic resilience

This indicates that NuoK, as part of NDH-1, is particularly important during anaerobic metabolism, which is relevant for infection scenarios where oxygen is limited .

How can one design effective mutagenesis studies for NuoK functional analysis?

Strategic approaches to mutagenesis include:

  • Target Selection:

    • Conserved residues identified through multiple sequence alignment

    • Charged residues in predicted transmembrane regions

    • Residues at interfaces with other subunits

  • Mutation Types:

    • Conservative substitutions maintaining physical properties

    • Charge-neutralizing or charge-reversing mutations

    • Cysteine substitutions for subsequent labeling studies

  • Experimental Design:

    • Complementation studies in deletion backgrounds

    • Inducible expression systems for toxic variants

    • Site-directed mutagenesis using established protocols

  • Phenotypic Analysis:

    • Growth assays under aerobic and anaerobic conditions

    • NADH dehydrogenase activity measurements

    • Proton pumping efficiency determination

    • Virulence assays in appropriate model systems

This systematic approach allows for detailed structure-function relationships to be established for NuoK .

What controls should be included when studying recombinant NuoK function?

Robust experimental design requires appropriate controls:

  • Positive Controls:

    • Wild-type NuoK expression

    • Known functional variants

    • Complete NDH-1 complex purification

  • Negative Controls:

    • Empty vector expression

    • Known non-functional variants (based on homology)

    • Inactive complex (e.g., with inhibitors)

  • Expression Controls:

    • Western blots to verify expression levels

    • Membrane localization confirmation

    • Complex assembly verification

  • Experimental Controls:

    • Normalization for cell number and protein content

    • Measurements at multiple time points

    • Technical and biological replicates

  • System-Specific Controls:

    • Inhibitor studies (rotenone, piericidin A)

    • Uncoupler studies (CCCP)

    • Ion dependency controls (Na+, K+ variations)

These controls ensure experimental validity and help distinguish specific effects of NuoK mutations from non-specific or system-related variations .

How can NuoK be leveraged for developing novel antimicrobial strategies?

NuoK and the NDH-1 complex offer potential antimicrobial targets:

  • Selective Targeting:

    • Exploiting structural differences between bacterial and human complex I

    • Targeting P. aeruginosa-specific features of NuoK

    • Developing inhibitors that specifically block proton translocation

  • Combination Approaches:

    • Pairing NDH-1 inhibitors with aminoglycosides

    • Dual targeting of multiple respiratory complexes

    • Combining metabolic and traditional antibiotic approaches

  • Screening Methods:

    • Structure-based virtual screening for NuoK binders

    • Whole-cell phenotypic screening with NDH-1 activity readouts

    • Fragment-based drug discovery targeting the membrane domain

  • Validation Studies:

    • Biochemical confirmation of target engagement

    • Resistance development monitoring

    • In vivo efficacy in infection models

The uniqueness of bacterial respiratory complexes and their importance for virulence make NuoK a promising target for novel antimicrobial development .

What are effective approaches for studying NuoK interactions within the complete NDH-1 complex?

Studying subunit interactions requires specialized approaches:

  • Crosslinking Methods:

    • Photo-reactive amino acid incorporation

    • Chemical crosslinking with MS/MS identification

    • Site-specific crosslinkers to probe defined interactions

  • Genetic Approaches:

    • Suppressor mutation analysis

    • Genetic complementation studies

    • Bacterial two-hybrid systems adapted for membrane proteins

  • Biophysical Methods:

    • FRET studies with fluorescently tagged subunits

    • Surface plasmon resonance with purified components

    • Native mass spectrometry of intact complexes

  • Computational Approaches:

    • Molecular dynamics simulations of subunit interactions

    • Coevolution analysis to identify interacting residues

    • Protein-protein docking simulations

  • Structural Biology:

    • Cryo-EM studies of the entire complex

    • X-ray crystallography of subcomplexes

    • Hydrogen-deuterium exchange mass spectrometry

What are common pitfalls in expression and purification of NuoK, and how can they be addressed?

Researchers often encounter specific challenges with membrane proteins like NuoK:

  • Low Expression Yields:

    • Solution: Test multiple expression systems (E. coli strains, homologous expression)

    • Solution: Optimize growth conditions (temperature, induction timing)

    • Solution: Use fusion partners (MBP, SUMO) to increase solubility

  • Protein Misfolding:

    • Solution: Expression at lower temperatures (16-20°C)

    • Solution: Addition of chemical chaperones to growth media

    • Solution: Co-expression with chaperone proteins

  • Aggregation During Purification:

    • Solution: Screen multiple detergents and detergent concentrations

    • Solution: Include lipids during purification

    • Solution: Use advanced solubilization technologies (nanodiscs, SMALPs)

  • Loss of Activity:

    • Solution: Minimize purification steps and time

    • Solution: Include stabilizing agents (glycerol, specific lipids)

    • Solution: Consider purifying the entire complex rather than individual subunits

These approaches can help overcome common obstacles in membrane protein research .

How can researchers resolve conflicting data regarding NuoK function or structure?

When facing contradictory results:

  • Methodology Assessment:

    • Critically evaluate differences in experimental approaches

    • Consider protein preparation methods and purity

    • Assess the sensitivity and specificity of assays used

  • Systematic Validation:

    • Reproduce experiments using multiple methods

    • Employ both in vitro and in vivo approaches

    • Use complementary techniques to address the same question

  • Variable Consideration:

    • Evaluate the impact of different genetic backgrounds

    • Consider environmental conditions and their effects

    • Assess post-translational modifications or conformational states

  • Collaborative Resolution:

    • Engage with other laboratories for independent verification

    • Consider standardizing protocols across research groups

    • Design definitive experiments to resolve specific contradictions

  • Formulation of Unified Models:

    • Develop hypotheses that explain seemingly contradictory results

    • Consider context-dependent functions

    • Use computational modeling to test complex scenarios

This systematic approach helps resolve conflicting data and advances understanding of complex membrane proteins like NuoK .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.