Recombinant Pseudomonas aeruginosa Nitric oxide reductase subunit C (norC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
norC; PA0523; Nitric oxide reductase subunit C; NOR small subunit; Nitric oxide reductase cytochrome c subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-146
Protein Length
Full Length of Mature Protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
norC
Target Protein Sequence
SETFTKGMARNIYFGGSVFFILLFLALTYHTEKTLPERTNEAAMSAAVVRGKLVWEQNNC VGCHTLLGEGAYFAPELGNVVGRRGGEEGFNTFLQAWMNIQPLNVPGRRAMPQFHLSEGQ VDDLAEFLKWSSKIDTNQWPPNKEG
Uniprot No.

Target Background

Function
A component of the anaerobic respiratory chain, this protein catalyzes the transformation of nitrate to dinitrogen (denitrification).
Gene References Into Functions
  1. Pseudomonas aeruginosa overexpression system of nitric oxide reductase for in vivo and in vitro mutational analyses. PMID: 29499184
  2. Studies suggest that increased hydrophilicity (e.g., I107E mutation) in the distal pocket enhances nitric oxide reductase (NOR) activity in sperm whale myoglobin. Proton transfer appears crucial in the biocatalysis by P. aeruginosa NOR subunit C. PMID: 27003474
Database Links

KEGG: pae:PA0523

STRING: 208964.PA0523

Subcellular Location
Cell membrane; Single-pass membrane protein. Note=May be attached to the membrane by a signal-anchor.

Q&A

What is Pseudomonas aeruginosa Nitric Oxide Reductase Subunit C (NorC) and its primary function?

Nitric Oxide Reductase Subunit C (NorC) is an integral membrane protein that forms part of the nitric oxide reductase complex (NorBC) in Pseudomonas aeruginosa. This complex catalyzes the reduction of nitric oxide (NO) to nitrous oxide (N₂O) during the denitrification process. The denitrification pathway allows P. aeruginosa to utilize nitrogen oxides as terminal electron acceptors under oxygen-limited conditions, following the reaction cascade: NO₃⁻ → NO₂⁻ → NO → N₂O → N₂. NorC specifically serves as one of the key components of this respiratory apparatus, helping the bacterium to adapt to various environmental conditions .

NorC also functions beyond its enzymatic role, serving as a structural component that helps organize the denitrification protein network. Research has shown that NorC, together with NorB and NosR, forms a core assembly platform that anchors other components of the denitrification machinery to the bacterial membrane .

How does NorC contribute to P. aeruginosa pathogenicity?

P. aeruginosa is a major opportunistic pathogen responsible for serious nosocomial infections, particularly among immunocompromised individuals with underlying conditions such as cancer, AIDS, or cystic fibrosis, as well as patients in intensive care units . The denitrification pathway, of which NorC is a critical component, enables P. aeruginosa to survive in oxygen-limited environments within the host, including biofilms and microaerobic infection sites.

Additionally, the denitrification ability contributes to P. aeruginosa's metabolic versatility, allowing it to thrive in diverse environments within the human body. The NorBC complex specifically detoxifies nitric oxide, which is produced by host immune cells as an antimicrobial agent, thus contributing to bacterial survival during infection . Interference with NorC function could potentially reduce bacterial fitness in infection settings, making it a target of interest for novel therapeutic approaches.

What is the structural organization of the NorBC complex?

The NorBC complex consists of two subunits: NorB and NorC. Based on the available research data, NorB and NorC are integral membrane proteins that form a stable complex in the cytoplasmic membrane of P. aeruginosa. The complex contains multiple heme groups that facilitate electron transfer during the reduction of nitric oxide .

Transmission electron microscopy and interactomic studies have confirmed that NorB and NorC are physically associated and serve as a structural foundation for the assembly of the complete denitrification apparatus. The complex is membrane-anchored, providing stability to the entire protein network involved in denitrification .

What protein-protein interactions have been identified for NorC?

Interactomic studies using affinity chromatography and liquid chromatography-tandem mass spectrometry (LC-MS/MS) have revealed numerous protein interactions involving NorC. The strongest interactions observed are with other proteins in the denitrification pathway, as summarized in the following table:

Interaction PartnerFold Enrichment with NorCFunction
NirF163.94Heme d1 biosynthesis protein
NarH12.06Respiratory nitrate reductase beta chain
NirQ10.54Regulatory protein for denitrification
NarG7.08Respiratory nitrate reductase alpha chain
NosL68.91Protein involved in nitrous oxide reduction
NosR52.88Regulatory protein for denitrification
NirM4.17Cytochrome c551, electron donor for nitrite reductase
NarK23.11Nitrite extrusion protein
NosZ2.61Nitrous oxide reductase
NirN2.27Heme d1 biosynthesis protein
NirS1.97Nitrite reductase

This data clearly demonstrates that NorC interacts extensively with proteins involved in every step of the denitrification pathway, from nitrate reduction (NarGH) to nitrite reduction (NirS) and nitrous oxide reduction (NosZ) . Particularly strong interactions were observed with NirF, a protein involved in the final steps of heme d1 biosynthesis, which is essential for nitrite reductase function.

What methodologies are commonly used to study NorC-protein interactions?

Several complementary methodologies have proven effective for investigating NorC interactions in the complex membrane environment:

  • Affinity Chromatography with Tagged Proteins: Researchers have successfully used His₆-tagged NorC to identify interaction partners. This approach involves expressing recombinant NorC-His₆ in P. aeruginosa, followed by membrane solubilization, affinity purification, and identification of co-purified proteins .

  • Immunogold Labeling with Electron Microscopy: Double immunolabeling of ultrathin sections combined with transmission electron microscopy has been employed to verify protein-protein interactions observed through biochemical techniques. This approach provides spatial information about the interaction between NorC and other proteins in the denitrification apparatus .

  • LC-MS/MS Analysis: Liquid chromatography-tandem mass spectrometry analysis of affinity-purified protein complexes allows quantitative assessment of protein interactions. Researchers calculate protein abundance indices and area values to determine the specificity and strength of interactions .

  • Genetic Approaches: Construction of norC deletion mutants, followed by phenotypic analysis of denitrification capabilities, provides functional evidence for the role of NorC in the denitrification protein network. Studies have shown that norC mutants exhibit reduced nitrite reduction activity, indicating the importance of NorC beyond its enzymatic function .

For optimal results, researchers should employ a combination of these approaches to validate interactions from multiple perspectives.

How is recombinant NorC typically produced for research purposes?

Production of recombinant NorC for research typically follows these methodological steps:

  • Gene Cloning: The norC gene, including its promoter region (approximately 400-500 bp upstream of the start codon), is PCR amplified from P. aeruginosa genomic DNA using specific primers (e.g., norCFw/norCRv) .

  • Vector Construction: The amplified gene is cloned into an appropriate vector system. For example, researchers have used a two-step cloning process: first inserting the PCR product into a carrier vector (such as pJET1.2), then transferring it to an expression vector containing an affinity tag (such as His₆) .

  • Transformation: The final construct (e.g., pAS40-norC-His₆) is transformed into either E. coli for initial verification or directly into P. aeruginosa for homologous expression.

  • Expression Conditions: For membrane proteins like NorC, expression conditions must be carefully optimized. Anaerobic or microaerobic growth conditions may enhance expression of denitrification proteins.

  • Protein Purification: Membrane fractions are isolated by ultracentrifugation, followed by solubilization using appropriate detergents. The His₆-tagged NorC is then purified using nickel affinity chromatography .

This approach ensures that recombinant NorC maintains its native conformation and functionality, which is crucial for subsequent structural and functional studies.

How do mutations in the norC gene affect P. aeruginosa physiology?

Genetic studies involving norC mutants have revealed several important effects on P. aeruginosa physiology:

  • Reduced Nitrite Reduction: P. aeruginosa norC mutants show significantly reduced nitrite reduction activity, similar to the defect observed in nirS (nitrite reductase) mutants. This suggests that NorC plays a role beyond its enzymatic function in nitric oxide reduction .

  • Impact on Nitrite Reductase Stability: NorC influences the formation and stability of NirS (nitrite reductase). The underlying mechanism involves protein-protein interactions between NorBC and components of the nitrite reduction apparatus, including NirS, NirF, and NirN .

  • Structural Role in Denitrification Complex: The defects observed in norC mutants indicate that NorC serves as a structural component of the denitrification protein network, contributing to the assembly and stability of the entire apparatus .

  • Altered Respiratory Capacity: Since NorC is part of the respiratory chain under anoxic conditions, mutations in norC reduce the bacterium's ability to generate energy in oxygen-limited environments, potentially affecting growth and survival during infection.

These findings highlight the multifunctional nature of NorC, which extends beyond its catalytic role in nitric oxide reduction to include structural and regulatory functions within the denitrification network.

What is the relationship between NorC and other components of the denitrification pathway?

NorC exhibits complex relationships with other components of the denitrification pathway, as evidenced by both genetic and interactomic studies:

  • Integration with Nitrite Reductase System: NorC interacts strongly with NirF, the final enzyme in heme d1 synthesis, which is essential for nitrite reductase (NirS) function. This interaction suggests a tight coupling between nitrite reduction and nitric oxide reduction steps. Additionally, NorC interacts with NirN, a structural homologue of NirS involved in nitrite reductase maturation, and with NirM, a c-type cytochrome that serves as an electron donor for nitrite reductase .

  • Coordination with Nitrate Reductase: NorC interacts with components of the nitrate reductase complex (NarGHI), particularly NarH (respiratory nitrate reductase beta chain). This interaction links the initial step of denitrification (nitrate reduction) with subsequent steps in the pathway .

  • Connection to Nitrous Oxide Reduction: NorC also interacts with NosR, a regulatory protein, and NosZ, the nitrous oxide reductase. These interactions connect the NorBC complex to the final step of denitrification .

  • Regulatory Interactions: NorC interacts with NirQ, an ATP-binding protein involved in regulating the denitrification process. This interaction may contribute to the coordinated expression and activity of the various denitrification enzymes .

These interactions demonstrate that NorC functions as part of an integrated protein network that coordinates all steps of the denitrification pathway in P. aeruginosa.

What challenges exist in studying membrane-bound enzymes like NorC?

Research on NorC and other membrane-bound enzymes presents several methodological challenges:

  • Protein Solubilization and Purification: As an integral membrane protein, NorC requires careful solubilization using detergents that maintain its native structure and function. The choice of detergent is critical, as inappropriate detergents can disrupt protein-protein interactions or denature the protein .

  • Maintaining Protein-Protein Interactions: The denitrification apparatus involves numerous protein-protein interactions that may be disrupted during purification. Techniques like chemical cross-linking prior to solubilization have been employed to preserve these interactions .

  • Heterologous Expression Limitations: Expression of functional membrane proteins in heterologous systems is often challenging. For NorC, expression in the native organism (P. aeruginosa) may be necessary to ensure proper folding, membrane insertion, and assembly into the NorBC complex .

  • Complex Cofactor Requirements: The NorBC complex contains multiple heme groups and other cofactors essential for function. Ensuring proper incorporation of these cofactors during recombinant expression is challenging.

  • Functional Assays in Membrane Environment: Assessing the enzymatic activity of membrane-bound NorC requires specialized assays that account for the membrane environment and maintain the integrity of the respiratory chain.

Researchers addressing these challenges may employ strategies such as gentle solubilization techniques, in situ studies using whole cells, and advanced imaging methods that provide information about membrane protein organization without extraction.

How can structural studies of NorC contribute to understanding P. aeruginosa pathogenesis?

Structural studies of NorC can provide valuable insights into P. aeruginosa pathogenesis through several mechanisms:

  • Identification of Critical Domains: Determining the structure of NorC would reveal domains essential for protein-protein interactions within the denitrification apparatus. These interaction sites could serve as targets for disrupting the assembly of the respiratory complex, potentially reducing bacterial fitness during infection .

  • Understanding Adaptation to Host Environments: P. aeruginosa encounters microaerobic and anaerobic environments during infection, particularly in biofilms and in the airways of cystic fibrosis patients. The structure of NorC and its interactions with other denitrification proteins illuminate how the bacterium adapts to these conditions .

  • Resistance Mechanism Insights: P. aeruginosa is known for its intrinsic resistance to antibiotics, which is partly due to its metabolic versatility. Structural studies of respiratory complexes like NorBC provide insights into this metabolic flexibility .

  • Novel Therapeutic Target Development: As an integral membrane protein essential for anaerobic respiration, NorC represents a potential target for new antimicrobial strategies. Structural information would facilitate the design of inhibitors that specifically disrupt NorC function or its interactions with other proteins .

  • Vaccine Development Considerations: Understanding the structure and surface-exposed domains of NorC could inform the development of vaccines targeting P. aeruginosa, similar to approaches using outer membrane vesicles (OMVs) that contain various membrane proteins .

Structural studies would ideally combine X-ray crystallography, cryo-electron microscopy, and computational modeling to generate a comprehensive understanding of NorC's structure and function in the context of the complete denitrification apparatus.

How does the NorBC complex coordinate with energy generation systems in P. aeruginosa?

Recent interactomic studies have revealed extensive connections between the NorBC complex and energy generation systems in P. aeruginosa:

  • Integration with Electron Transport Chain: The denitrification apparatus, including NorBC, interacts with various electron-donating dehydrogenases that feed electrons into the respiratory chain. These interactions suggest a coordinated electron flow from primary dehydrogenases to terminal reductases .

  • Association with ATP Synthase: Remarkably, the complete ATP synthase complex has been found to interact with denitrification proteins, including NorC. This physical association may facilitate efficient energy coupling between electron transport through the denitrification pathway and ATP synthesis .

  • TCA Cycle Connections: Almost all enzymes of the tricarboxylic acid (TCA) cycle have been found to interact with denitrification proteins. This suggests a direct metabolic channeling between central carbon metabolism and respiratory functions .

  • Protein Transport Systems: The Sec system of protein transport has been found to associate with the denitrification proteins, potentially facilitating the proper localization and assembly of membrane-bound respiratory complexes .

These interactions suggest that the denitrification apparatus, including NorC, is part of a comprehensive "nitrate respirasome" – an extensive protein network anchored to the cytoplasmic membrane that coordinates energy generation under anaerobic conditions.

What methodological advances have improved the study of NorC and related proteins?

Several methodological advances have enhanced our ability to study complex membrane proteins like NorC:

  • Membrane Interactomics: The combination of affinity purification, chemical cross-linking, and mass spectrometry has enabled the detailed characterization of protein-protein interactions involving membrane proteins. This approach has revealed the extensive interaction network of NorC with other denitrification proteins .

  • Electron Microscopy Colocalization: Double immunolabeling of ultrathin sections combined with transmission electron microscopy provides spatial information about protein-protein interactions in their native membrane environment. This technique has been used to verify interactions identified through biochemical approaches .

  • Quantitative Interaction Analysis: Advanced mass spectrometry techniques enable the calculation of protein abundance indices and area values, allowing researchers to quantitatively assess the specificity and strength of protein interactions .

  • Genetic Engineering Tools: PCR-based techniques for gene amplification and cloning, combined with efficient transformation methods, have facilitated the construction of tagged versions of NorC for purification and interaction studies. For example, the creation of NorC-His₆ constructs has enabled affinity purification of the protein and its interaction partners .

These methodological advances have collectively enhanced our understanding of NorC's role in the complex denitrification apparatus of P. aeruginosa, providing insights that may ultimately contribute to new strategies for combating this challenging pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.