Recombinant Pseudomonas aeruginosa Phosphate regulon sensor protein phoR (phoR)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
phoR; PA5361; Phosphate regulon sensor protein PhoR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
phoR
Target Protein Sequence
MQSVVNQDWRGALIRHLLLVLAASLVLGVVSGHYGWALALGLALYLGWTLWQLLRLHQWL RNHQPDEPPPDSYGLWGEVFDNIYHLQRRNQRARGRLQAVIDRIQESTAALRDAVIMLDS DGNLEWWNLAAENLLGLKTPQDGGQPVSNLIRHPRFKEYFDQEDYREPLEIPSPINERLR LQFHITLYGNREHLMLVRDVTRVHQLEQMRKDFVANVSHELRTPLTVIAGYLETLLDNVE DVNPRWLRALQQMQQQAGRMQNLLNDLLLLAKLEATDYPGDNKPVAVDALLASIRNDAQA LSAGRNHRISLDAAPAVQLKGSEAELRSAFSNLVFNAVKYTPDEGEIRIRWWADEQGAHL SVQDTGIGVDPKHLPRLTERFYRVDSSRASNTGGTGLGLAIVKHVLIRHRARLEISSVPG KGSTFTCHFAPAQVAEAERKAPK
Uniprot No.

Target Background

Function
A component of the two-component PhoR/PhoB regulatory system controlling phosphate regulon gene expression. PhoR is believed to function as a membrane-associated protein kinase, phosphorylating PhoB in response to environmental stimuli.
Database Links

KEGG: pae:PA5361

STRING: 208964.PA5361

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the phosphate regulon sensor protein PhoR in Pseudomonas aeruginosa and how does it function?

PhoR is a histidine kinase that functions as part of the PhoR-PhoB two-component regulatory system in Pseudomonas aeruginosa. This system is activated under phosphate-depleted conditions, with PhoR serving as the sensor kinase that detects environmental phosphate limitation. Upon sensing low phosphate, PhoR undergoes autophosphorylation and subsequently transfers the phosphoryl group to PhoB, activating this response regulator .

The mechanism involves:

  • Detection of phosphate limitation by the sensor domain of PhoR

  • Autophosphorylation of PhoR at a conserved histidine residue

  • Transfer of the phosphoryl group to an aspartate residue in PhoB

  • Activation of PhoB, enabling it to bind to specific DNA sequences (PHO boxes)

  • Transcriptional regulation of genes involved in phosphate acquisition and virulence

In P. aeruginosa, PhoR activation is specifically triggered by low pH conditions associated with phosphate starvation, making it a critical environmental sensor .

How does phosphate limitation influence Pseudomonas aeruginosa virulence through the PhoR-PhoB system?

Phosphate limitation serves as an environmental cue that triggers virulence in P. aeruginosa through the PhoR-PhoB regulatory pathway. The connection between phosphate starvation and virulence is multifaceted:

  • Under phosphate-depleted conditions, the PhoR-PhoB system activates transcription of multiple virulence-associated genes

  • PhoB specifically up-regulates the Rhl quorum sensing system, which controls production of numerous virulence factors

  • This activation results in enhanced production of rhamnolipids, biosurfactants that facilitate swarming motility

  • Phosphate limitation also augments Pseudomonas quinolone signal (PQS) and pyocyanin production, important virulence determinants

Research has demonstrated that mutations in phoB prevent P. aeruginosa from expressing the phosphate starvation response even under phosphate-limited conditions, resulting in no swarming motility . This highlights how the PhoR-PhoB system translates environmental phosphate levels into behavioral changes that enhance pathogenicity.

What is the relationship between the PhoR-PhoB system and quorum sensing in Pseudomonas aeruginosa?

The PhoR-PhoB two-component system and quorum sensing networks in P. aeruginosa are intricately connected, forming a sophisticated regulatory network that coordinates bacterial responses to both environmental conditions and population density:

PhoR-PhoB Impact on QS SystemsMechanismOutcome
Rhl systemTranscriptional activation of rhlREnhanced production of rhamnolipids and virulence factors
Las systemCompetitive binding against LasR and RsaL at the lasI promoterSignificant expression of lasI
PQS systemActivation of pqsA and mvfRAugmented PQS and pyocyanin production

Evidence shows that the phosphate regulon is directly involved in transcriptional activation of rhlR and subsequent enhancement of PQS and pyocyanin production under phosphate limitation conditions . PhoB acts as a strong competitor against LasR and RsaL for binding to the promoter of lasI, inducing significant expression of lasI, rhlR, and mvfR .

This cross-talk between phosphate sensing and quorum sensing integrates multiple environmental signals to coordinate population-level behaviors critical for virulence and adaptation.

What methodological approaches are used to study PhoR-PhoB interactions in experimental settings?

Several experimental approaches are employed to investigate PhoR-PhoB interactions in P. aeruginosa:

Genetic Techniques:

  • Allelic exchange for precise gene knockouts, knockins, and single nucleotide modifications to study protein function

  • Creation of single and double mutants (e.g., pstS, phoB, and pstS/phoB double mutants) to assess phenotypic effects

  • Complementation studies using multicopy shuttle vectors containing phoR-phoB genes

Biochemical and Molecular Methods:

  • Recombinant protein expression and purification systems for in vitro studies

  • Phosphorylation assays to monitor PhoR autophosphorylation and phosphotransfer to PhoB

  • DNA binding assays to assess PhoB interaction with PHO box sequences

Phenotypic Analysis:

  • Swarming motility assays to evaluate the impact of phoR-phoB mutations

  • Rhamnolipid production measurement to assess quorum sensing activation

  • Antimicrobial susceptibility testing to evaluate the role in antibiotic resistance

Transcriptomic Approaches:

  • RT-PCR and RNA-seq to identify genes regulated by the PhoR-PhoB system

  • Promoter-reporter fusions to monitor gene expression in response to phosphate limitation

These methodologies are often combined to provide comprehensive insights into the complex regulatory role of the PhoR-PhoB system.

How can recombinant Pseudomonas aeruginosa PhoR be optimally expressed and purified for structural and functional studies?

The optimal expression and purification of recombinant P. aeruginosa PhoR protein involves multiple strategic considerations:

Expression System Selection:

  • Escherichia coli is the preferred heterologous host due to its rapid growth, high protein yields, and genetic tractability

  • BL21(DE3) or Rosetta strains are recommended to address codon bias issues

  • For membrane-associated domains of PhoR, specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression are preferable

Vector Design and Construct Optimization:

  • Incorporate a hexahistidine (His6) tag for affinity purification, preferably at the N-terminus to avoid interference with C-terminal functional domains

  • Consider including a cleavable tag using TEV or 3C protease sites if tag-free protein is required

  • Clone specific domains separately (sensor domain, DHp domain, catalytic domain) when full-length protein expression proves challenging

Expression Conditions:

  • Induction at lower temperatures (16-18°C) overnight often improves solubility

  • IPTG concentration optimization (typically 0.1-0.5 mM)

  • Supplementation with specific additives like glycerol (5-10%) to enhance stability

Purification Strategy:

  • Initial capture using immobilized metal affinity chromatography (IMAC)

  • Ion exchange chromatography to remove nucleic acid contamination

  • Size exclusion chromatography for final polishing and buffer exchange

  • Maintain phosphate-free buffers throughout purification to prevent inadvertent activation

Quality Control Assessments:

  • SDS-PAGE and western blotting to verify purity and identity

  • Mass spectrometry to confirm protein integrity

  • Circular dichroism to assess secondary structure

  • Dynamic light scattering to evaluate monodispersity

This systematic approach yields high-quality recombinant PhoR suitable for downstream enzymatic, structural, and interaction studies.

What precision-engineering techniques can be applied to study phoR function in Pseudomonas aeruginosa?

Several state-of-the-art precision-engineering techniques have been developed specifically for modifying P. aeruginosa genes like phoR:

Allelic Exchange Method:
This two-step process allows seamless mutations precise to a single base pair without requiring heterologous recombinases :

  • Create a suicide vector containing the mutant allele flanked by homologous regions

  • Introduce the vector into recipient cells by conjugation

  • Select for antibiotic-resistant single-crossover merodiploids

  • Isolate unmarked double-crossover mutants using sucrose counter-selection

CRISPR-Cas9 System Adaptations:

  • Modified CRISPR-Cas9 systems specifically adapted for P. aeruginosa

  • Enables precise editing without antibiotic selection markers

  • Allows multiplexed editing of several genes simultaneously

Site-Directed Mutagenesis Applications:

  • Creation of point mutations in conserved active site residues

  • Modification of phosphorylation sites to study activation mechanisms

  • Introduction of reporter tags for live-cell imaging

Domain Swapping Approaches:

  • Replacement of sensor domains to investigate signal specificity

  • Creation of chimeric proteins with sensors from other two-component systems

  • Introduction of heterologous output domains to engineer novel responses

These techniques have been successfully deployed across diverse P. aeruginosa strains, including laboratory strains PAO1 and PA14, as well as clinical isolates from various infection sites, with a reported success rate of approximately 50% for environmental and clinical isolates .

How does recombination contribute to phenotypic diversity in the phoR-phoB system across Pseudomonas aeruginosa populations?

Recombination plays a fundamental role in generating phenotypic diversity in the phoR-phoB system across P. aeruginosa populations:

Mechanisms of Diversity Generation:

  • Horizontal gene transfer (HGT) and recombination contribute more significantly to genetic diversity than spontaneous mutation

  • Study of 44 P. aeruginosa isolates from a single cystic fibrosis patient revealed high intra-isolate diversity (5-64 SNPs) driven primarily by recombination

  • Phenotypic differences between isolates were statistically associated with distinct recombination events rather than mutations in known genes

Population Structure and Recombination:

  • P. aeruginosa exhibits a non-clonal epidemic population structure characterized by frequent recombinations

  • This creates a "superficially clonal structure" where occasionally highly successful epidemic clones emerge

  • Analysis of 328 isolates from diverse habitats across 30 countries confirmed this population structure using multiple genetic markers

Implications for phoR-phoB System:

  • Recombination events affecting the phoR-phoB locus can introduce substantial phenotypic variation in phosphate sensing abilities

  • These events can lead to altered virulence, antibiotic resistance profiles, and adaptation to specific environments

  • Non-congruence between different genetic markers indicates that recombination shuffles genetic elements, creating new combinations of functional variants

The evidence suggests that rather than a single optimized phoR-phoB system, P. aeruginosa maintains a diverse array of functional variants through recombination, allowing rapid adaptation to changing phosphate conditions across different ecological niches.

What are the molecular mechanisms of PhoB-mediated transcriptional regulation during phosphate stress in Pseudomonas aeruginosa?

The molecular mechanisms of PhoB-mediated transcriptional regulation involve several coordinated steps:

PhoB Activation and Binding:

  • Phosphorylated PhoB binds to specific DNA sequences called PHO boxes in the promoter regions of target genes

  • P. aeruginosa PHO boxes share similarities with the E. coli consensus sequence: CTGTCAT-A(A/T)A(T/A)-CTGT(C/A)A(C/T)

  • Genome-wide analysis identified 237 putative PHO boxes in P. aeruginosa, representing 417 potential downstream genes

Target Gene Regulation:
PhoB directly regulates multiple gene systems:

Gene CategoryExamplesFunctional Outcomes
Phosphate acquisitionpstC, pstA, pstB, phoUEnhanced phosphate uptake and transport
Quorum sensingrhlR, rhlI, lasRCoordination of population responses
Virulence factorsphzA2/phzA1Production of phenazines and other toxins

Competitive Binding Mechanisms:

  • At certain promoters, PhoB competes with other regulators for binding sites

  • For example, PhoB outcompetes LasR and RsaL for binding to the lasI promoter under phosphate limitation

  • This competitive binding creates a sophisticated regulatory network integrating multiple environmental signals

Indirect Regulation:

  • Beyond direct transcriptional control, PhoB indirectly influences numerous pathways

  • Activation of rhlR leads to subsequent effects on rhamnolipid production and swarming motility

  • Upregulation of quorum sensing systems triggers cascades of secondary responses

These molecular mechanisms allow P. aeruginosa to orchestrate complex adaptive responses to phosphate limitation that enhance survival and virulence.

What experimental designs are best suited for analyzing the impact of phoR mutations on Pseudomonas aeruginosa virulence and antibiotic resistance?

Comprehensive experimental designs for analyzing phoR mutations should incorporate multiple approaches:

Genetic Manipulation Strategies:

  • Creation of clean deletion mutants using allelic exchange methods

  • Site-directed mutagenesis of key functional domains (sensor, DHp, catalytic)

  • Complementation studies with wild-type and mutant variants

  • Construction of reporter fusions to monitor phosphate-responsive gene expression

Virulence Assessment Methods:

  • In vitro Assays:

    • Swarming motility assays on low-phosphate media

    • Quantification of virulence factors (pyocyanin, elastase, rhamnolipids)

    • Biofilm formation assays under various phosphate concentrations

    • Host cell invasion and cytotoxicity assays

  • In vivo Models:

    • Murine pulmonary infection models

    • Galleria mellonella infection model for high-throughput screening

    • Caenorhabditis elegans killing assays

Antibiotic Resistance Evaluation:

  • Minimum inhibitory concentration (MIC) determination across antibiotic classes

  • Time-kill kinetics under various phosphate conditions

  • Mixed population antibiotic susceptibility testing (crucial finding: resistance significantly increases when multiple isolates are tested together)

  • Adaptive resistance development rate measurements

Omics-Based Approaches:

  • RNA-Seq to identify differentially expressed genes in phoR mutants

  • ChIP-Seq to map genome-wide PhoB binding sites

  • Metabolomics to detect changes in cellular physiology

  • Proteomics to identify post-transcriptional effects

Clinical Isolate Comparisons:

  • Phenotypic and genotypic characterization of PhoR variants in clinical isolates

  • Correlation of phoR mutations with antibiotic resistance profiles

  • Analysis of selection pressure on phoR in chronic infection environments

This multi-faceted experimental design provides comprehensive insights into how phoR mutations affect the complex interplay between phosphate sensing, virulence, and antibiotic resistance in P. aeruginosa.

How can systems biology approaches be used to model the PhoR-PhoB regulatory network in Pseudomonas aeruginosa?

Systems biology offers powerful frameworks for understanding the complex PhoR-PhoB regulatory network:

Network Reconstruction Methods:

  • Integration of transcriptomic, proteomic, and metabolomic data to build comprehensive network models

  • ChIP-seq and RNA-seq data combination to identify direct and indirect regulatory relationships

  • Minimum spanning tree (MST) analysis to visualize complex regulatory interactions

  • Bayesian network modeling to infer causal relationships between phosphate stress and downstream responses

Mathematical Modeling Approaches:

  • Ordinary differential equation (ODE) models to capture dynamics of phosphorylation cascades

  • Boolean network models for qualitative representation of regulatory interactions

  • Constraint-based models integrating metabolic and regulatory networks

  • Agent-based models to simulate population-level behaviors emergent from single-cell regulatory events

Key Model Components:

  • PhoR autophosphorylation kinetics under varying phosphate concentrations

  • Phosphotransfer rates to PhoB

  • PhoB-DNA binding affinities at different promoters

  • Competition dynamics between PhoB and other transcription factors

  • Feedback loops through phosphate acquisition systems

Validation and Refinement Strategies:

  • Testing model predictions with targeted experiments

  • Parameter estimation from experimental time-course data

  • Sensitivity analysis to identify critical control points

  • Iterative model refinement based on new experimental findings

Practical Applications:

  • Identification of potential therapeutic targets within the network

  • Prediction of bacterial responses to combination therapies

  • Modeling evolutionary trajectories under antibiotic selection pressure

  • Designing synthetic biology interventions to rewire phosphate response

By integrating diverse experimental data into coherent mathematical frameworks, systems biology approaches can reveal emergent properties of the PhoR-PhoB system not apparent from reductionist studies alone.

What are the most significant technical challenges in studying the PhoR-PhoB phosphorylation cascade, and how can they be addressed?

Investigating the PhoR-PhoB phosphorylation cascade presents several technical challenges that require specialized approaches:

Challenges in Protein Stability and Activity:

  • PhoR, being a membrane-associated histidine kinase, is often difficult to express in soluble, active form

  • The phosphoryl group on histidine residues is labile at acidic pH, complicating analysis

  • PhoB undergoes conformational changes upon phosphorylation that affect interaction studies

Methodological Solutions:

  • For Protein Expression:

    • Expression of truncated constructs lacking transmembrane domains

    • Fusion with solubility-enhancing tags (MBP, SUMO)

    • Cell-free expression systems for difficult constructs

  • For Phosphorylation Studies:

    • Use of phosphoramidate as chemical phosphodonor for PhoB

    • Phosphorylation-mimicking mutations (D→E substitutions)

    • Phos-tag SDS-PAGE for separation of phosphorylated and non-phosphorylated forms

    • 32P labeling for sensitive detection of phosphotransfer

  • For Structural Studies:

    • Co-crystallization of PhoR-PhoB complexes with non-hydrolyzable ATP analogs

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Cryo-EM for capturing different conformational states

  • For In Vivo Analysis:

    • Development of phosphorylation-specific antibodies

    • FRET-based biosensors to monitor PhoR-PhoB interactions in live cells

    • Optogenetic tools to control PhoR activation with light

These approaches collectively address the significant technical barriers to studying the PhoR-PhoB phosphorylation cascade, enabling more accurate and comprehensive analysis of this critical regulatory system.

How can transcriptomic and proteomic approaches be integrated to fully characterize the PhoB regulon in Pseudomonas aeruginosa?

An integrated multi-omics approach provides the most comprehensive characterization of the PhoB regulon:

Experimental Design for Integration:

  • Parallel Sample Processing:

    • Grow cultures under identical conditions with defined phosphate levels

    • Harvest samples simultaneously for RNA and protein extraction

    • Include appropriate replicates and time points to capture dynamic responses

  • Transcriptomic Methods:

    • RNA-Seq to identify differentially expressed genes in wild-type vs. phoB mutants

    • ChIP-Seq with anti-PhoB antibodies to map direct binding sites genome-wide

    • 5' RACE to identify precise transcription start sites of PhoB-regulated genes

    • Single-cell RNA-Seq to capture population heterogeneity in phosphate responses

  • Proteomic Methods:

    • Quantitative proteomics (TMT or SILAC) to measure protein-level changes

    • Phosphoproteomics to identify secondary signaling events

    • Protein-protein interaction mapping (AP-MS) to identify PhoB interactors

    • Protein turnover analysis to distinguish regulation at synthesis vs. degradation levels

Data Integration Strategies:

  • Correlation analysis between transcript and protein abundance changes

  • Pathway enrichment analysis across both datasets

  • Network reconstruction incorporating both transcriptional and post-transcriptional regulation

  • Identification of discordant genes (changed at RNA but not protein level or vice versa)

Validation Approaches:

  • Reporter gene assays for selected promoters

  • Targeted proteomics (PRM/MRM) for key regulated proteins

  • Mutational analysis of predicted PhoB binding sites

  • Phenotypic testing of mutations in newly identified regulon members

This integrated approach overcomes the limitations of individual methods, providing a systems-level understanding of how the PhoB regulon orchestrates P. aeruginosa's response to phosphate limitation at both transcriptional and post-transcriptional levels.

What are the implications of PhoR-PhoB system variants for antimicrobial resistance development in clinical Pseudomonas aeruginosa isolates?

The PhoR-PhoB system significantly influences antimicrobial resistance through multiple mechanisms:

Direct and Indirect Effects on Resistance:

MechanismDescriptionImpact on Resistance
Membrane permeabilityPhoB regulates outer membrane protein compositionAltered uptake of hydrophilic antibiotics
Efflux pump regulationPhosphate limitation affects expression of efflux systemsEnhanced export of multiple antibiotic classes
Biofilm formationPhoR-PhoB system influences biofilm developmentIncreased tolerance to antimicrobials in biofilms
Metabolic adaptationPhosphate stress responses alter cellular physiologyMetabolic state changes affecting antibiotic efficacy
Population heterogeneityRecombination affecting phoR-phoB creates diverse variantsMixed populations show increased collective resistance

Clinical Relevance:

  • Epidemic MDR clones, particularly serotype O12, show distinct phosphate response profiles

  • Research demonstrates that resistance significantly increases when multiple isolates with different phoR-phoB variants are mixed together

  • The non-clonal epidemic population structure of P. aeruginosa, driven by recombination, contributes to the spread of resistant phenotypes

Therapeutic Implications:

  • PhoR-PhoB inhibitors could potentially re-sensitize bacteria to existing antibiotics

  • Understanding phosphate-dependent resistance mechanisms may inform more effective combination therapies

  • Patient-specific phosphate levels (e.g., in CF lung) may influence optimal treatment strategies

  • Surveillance of phoR-phoB variants could help predict treatment outcomes

This research highlights how the PhoR-PhoB system represents both a challenge for antimicrobial therapy and a potential target for novel therapeutic approaches in combating resistant P. aeruginosa infections.

How does the function of the PhoR-PhoB system in Pseudomonas aeruginosa compare with analogous systems in other clinically relevant bacteria?

The PhoR-PhoB system displays both conserved features and species-specific adaptations across different bacterial pathogens:

Comparative Analysis of PhoR-PhoB Systems:

OrganismSimilarities to P. aeruginosaKey DifferencesClinical Implications
Escherichia coliCore phosphate sensing mechanism
Similar PHO box consensus sequence
Different regulation of virulence factors
Less extensive quorum sensing integration
Provides foundational understanding of mechanism
Mycobacterium tuberculosisTwo-component phosphate sensing
Link to virulence regulation
Expanded role in cell wall remodeling
Different downstream targets
Basis for attenuated vaccine development
Vibrio choleraePhosphate-dependent virulence regulationDifferent coordination with quorum sensingAffects transmission dynamics
Staphylococcus aureusBasic phosphate sensing mechanismDifferent integration with virulence regulonsInfluences biofilm-associated infections

Evolutionary Conservation and Divergence:

  • Core signaling mechanisms (histidine phosphorylation, phosphotransfer, response regulator activation) are conserved

  • DNA binding specificity and regulon composition show significant divergence

  • Integration with other regulatory networks (e.g., quorum sensing) varies considerably

  • Environmental triggers for activation may extend beyond phosphate limitation in some species

Methodological Approaches for Comparative Studies:

  • Heterologous expression to test functional conservation

  • Domain swapping between species to identify specificity determinants

  • Comparative genomics to map regulon evolution

  • Phylogenetic analysis of sequence conservation across bacterial phyla

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.