Recombinant Pseudomonas aeruginosa Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; PA1635; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
kdpC
Target Protein Sequence
MFKQLRPALASLLVLSLVTGVAYPLLVTGIAQLAFPEQANGSLLRDAEGKVLGSRLIAQK FDGEEWFHSRPSAGDYATVSSAASNLAPSNPALAERIARDAAQERIADQGPVPLALVTTS GSGLDPQLPPQAARYQALRVATARGLPLRLVEDLVESHTERPLVGPAVVNVLALNMALAG LKR
Uniprot No.

Target Background

Function

This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this KdpC subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links

KEGG: pae:PA1635

STRING: 208964.PA1635

Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the KdpFABC complex and what role does KdpC play within it?

The KdpFABC complex is a high-affinity potassium transport system in Pseudomonas aeruginosa that combines features of a primary active P-type ATPase with the high affinity and selectivity of an ion channel. While ATP hydrolysis is accomplished by the P-type ATPase subunit KdpB, KdpA has traditionally been assumed to be the K+-translocating subunit .

KdpC is a crucial component that appears to function similarly to β subunits of Na+/K+ ATPase and gastric H+ ATPase. Based on structural and functional analyses, KdpC likely increases K+ affinity for the complex. Its proximity to the selectivity filter and absence of significant conformational changes during transport cycles suggests it plays a regulatory role rather than directly participating in ion translocation .

How does the KdpFABC complex differ from other potassium transport systems?

The KdpFABC complex represents a unique chimeric system between a transporter and a channel. Unlike other members of the superfamily of K+ transporters (SKT) such as KtrB and TrkH, the KdpA subunit alone does not support potassium ion uptake when expressed independently .

What makes this complex particularly interesting is its proposed transport mechanism that combines:

  • The energy-coupling capabilities of a P-type ATPase

  • The selectivity and affinity characteristics of an ion channel

This hybrid functionality enables efficient potassium transport even in environments with extremely low external potassium concentrations (as high as 10^4) .

What is the evolutionary significance of the KdpFABC complex?

The KdpFABC complex demonstrates how conserved protein architectures can merge together through evolution to adapt to different environmental requirements. The complex appears to have evolved by combining elements of both channels and transporters to create a hybrid system that can efficiently pump potassium ions despite low external concentrations .

This evolutionary adaptation highlights how bacterial transport systems can develop novel mechanisms by repurposing existing protein structures, demonstrating that conserved protein architectures not only evolve from one another but can merge to create functionally distinct systems with selective advantages in specific environments .

How do mutations in kdpC affect the function of the KdpFABC complex in P. aeruginosa?

Mutations in kdpC can significantly impact the potassium transport capability of the KdpFABC complex. Because KdpC appears to function in modulating K+ affinity, mutations can alter:

  • The binding affinity of potassium ions

  • The regulatory control of transport activity

  • The structural stability of the complex

Researchers investigating kdpC mutations should examine alterations in:

  • Ion selectivity profiles

  • Transport kinetics (Vmax, Km)

  • ATP hydrolysis rates

  • Conformational changes in the complex

When designing experiments to study kdpC mutations, it's crucial to employ complementation studies with wild-type kdpC to confirm the phenotypic effects are directly attributable to the mutation rather than polar effects on other genes. Additionally, site-directed mutagenesis targeting conserved residues can provide insights into structure-function relationships .

What is the proposed transport mechanism for potassium via the KdpFABC complex?

The current model suggests a mechanism involving two joined half-channels formed by KdpA and KdpB. In this model:

  • Substrate occlusion occurs at the canonical binding site of the P-type ATPase KdpB

  • High K+ selectivity and affinity are achieved through the selectivity filter of KdpA

  • The ion channel pore remains closed

  • Potassium ions are redirected through the P-type ATPase subunit

This proposed mechanism explains how potassium ions can be actively pumped against a concentration gradient as high as 10^4. Importantly, the alternating access of the binding site with outward-facing E1 and inward-facing E2 states appears to be reversed compared to classical P-type ATPases .

The transport cycle remains controversial, with some studies supporting this model and others providing evidence for a classical reaction cycle. For example, studies by Siebers and Altendorf showed that the KdpFABC complex was maximally phosphorylated upon ATP addition in the absence of K+, with K+ addition inducing dephosphorylation, which contradicts aspects of the proposed model .

How can recombinant kdpC be utilized in developing P. aeruginosa vaccines?

P. aeruginosa is a major opportunistic pathogen with increasing antibiotic resistance, making vaccine development an important alternative strategy. While no specific vaccines targeting kdpC are described in the provided literature, the approach would involve:

  • Expressing recombinant kdpC as an antigen

  • Incorporating it into appropriate delivery systems such as outer membrane vesicles (OMVs)

Based on research with other P. aeruginosa antigens, a successful vaccine development approach might:

  • Express kdpC in attenuated P. aeruginosa strains (similar to the PA-m14 strain described for other antigens)

  • Incorporate the kdpC into OMVs to enhance immunogenicity while reducing toxicity

  • Potentially create fusion proteins combining kdpC with other immunogenic proteins

The effectiveness of such vaccines would need to be evaluated through measurement of:

  • Antibody titers

  • T-cell responses

  • Protection against challenge with virulent P. aeruginosa strains

  • Cross-protection against different clinical isolates

What expression systems are optimal for producing recombinant P. aeruginosa kdpC?

When producing recombinant kdpC from P. aeruginosa, researchers should consider several expression systems:

  • E. coli-based expression systems:

    • pET vector systems for high-level expression

    • Control expression with IPTG-inducible promoters

    • Consider fusion tags (His, GST, MBP) to facilitate purification and potentially enhance solubility

  • Pseudomonas-based expression systems:

    • Using pSMV83-type plasmids for expression within Pseudomonas

    • Expression in attenuated P. aeruginosa strains like PA-m14

    • Potential for incorporation into outer membrane vesicles

  • Yeast expression systems:

    • Saccharomyces cerevisiae recombination techniques as described for other Pseudomonas proteins

    • Useful for creating in-frame deletions and complementation constructs

Expression SystemAdvantagesChallengesRecommended Applications
E. coliHigh yield, established protocolsPotential folding issuesStructural studies, antibody production
P. aeruginosaNative folding, post-translational modificationsLower yieldsFunctional studies, OMV vaccines
YeastEukaryotic folding machineryComplex protocolsLarge-scale production, glycosylated variants

What purification strategies are effective for recombinant P. aeruginosa kdpC?

Purification of recombinant kdpC requires careful consideration of its biochemical properties and intended applications:

  • Affinity chromatography:

    • His-tagged variants can be purified using Ni-NTA resins

    • GST-fusion proteins can be purified on glutathione columns

    • Consider on-column cleavage of fusion tags if the native protein is required

  • Ion exchange chromatography:

    • Useful for further purification based on the protein's isoelectric point

    • Can help remove contaminating bacterial proteins

  • Size exclusion chromatography:

    • Final polishing step to obtain highly pure protein

    • Useful for separating monomeric from oligomeric forms

For membrane-associated forms of kdpC, detergent selection is critical:

  • Mild detergents like DDM or LMNG preserve native structure

  • Detergent screening should be performed to optimize stability

  • Consider amphipols or nanodiscs for functional studies

What techniques are valuable for studying kdpC interactions within the KdpFABC complex?

Understanding kdpC's role within the KdpFABC complex requires sophisticated approaches:

  • Cryo-electron microscopy (Cryo-EM):

    • Has been successfully used to determine structures of KdpFABC

    • Reveals conformational states during the transport cycle

    • Can identify interaction surfaces between complex components

  • Co-immunoprecipitation studies:

    • Useful for confirming protein-protein interactions in vivo

    • Can identify additional interaction partners in the bacterial membrane

  • Site-directed mutagenesis:

    • Targeted mutations can disrupt specific interactions

    • Particularly valuable at putative interfaces between kdpC and other subunits

  • Functional assays:

    • Potassium uptake assays using radioisotopes (86Rb+ or 42K+)

    • Growth complementation in K+-limited conditions

    • ATPase activity measurements to correlate structure with function

  • Computational approaches:

    • Molecular dynamics simulations of the complex

    • Prediction of conformational changes during transport cycles

    • Virtual screening for potential inhibitors or modulators

How can understanding kdpC contribute to antibiotic resistance research in P. aeruginosa?

P. aeruginosa is a leading nosocomial pathogen with increasing rates of multidrug resistance (MDR) and extensively drug-resistant (XDR) strains . Understanding kdpC function could contribute to antibiotic resistance research in several ways:

  • Novel target identification:

    • The essential nature of potassium transport makes the KdpFABC complex a potential target

    • Compounds disrupting kdpC-mediated regulation could potentially sensitize resistant strains

  • Physiological adaptations:

    • Potassium homeostasis may influence adaptations to antibiotic stress

    • The role of kdpC in modulating transport activity might impact metabolic responses to antibiotics

  • Stress response mechanisms:

    • Understanding how potassium transport systems respond to environmental stresses

    • Potential connections between osmotic stress responses and antibiotic resistance

What role might kdpC play in P. aeruginosa virulence and host-pathogen interactions?

While direct evidence for kdpC's role in virulence is not presented in the provided literature, ion transport systems are often critical for bacterial adaptation to host environments:

  • Adaptation to ion-limited environments:

    • Host environments often restrict essential nutrients including ions

    • High-affinity potassium transport may be crucial for survival in potassium-limited host niches

  • Metabolic regulation:

    • Potassium homeostasis affects numerous metabolic pathways

    • Similar to how CbrAB two-component systems influence metabolism and substrate prioritization

  • Biofilm formation:

    • Ion transport systems can influence biofilm development

    • Biofilms are a key virulence determinant in P. aeruginosa infections, particularly in cystic fibrosis

Future research should examine correlations between kdpC expression/function and clinical outcomes in patients with P. aeruginosa infections, particularly in chronic respiratory infections where adaptation to the host environment is critical .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.