Recombinant Pseudomonas aeruginosa Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

  • Gene locus: PA14_04460 (lgt) in P. aeruginosa UCBPP-PA14 .

  • Genomic location: Chromosomal (397,899–398,699 bp, + strand) .

  • Protein properties:

    PropertyValue
    Molecular weight29.8 kDa
    Isoelectric point (pI)9.93
    Charge (pH 7)+9.85
    Hydrophobicity (Kyte-Doolittle)0.525
    UniProt IDQ02U74

The enzyme is predicted to have seven transmembrane domains, with its N-terminus facing the periplasm . Structural homology modeling based on Escherichia coli Lgt (51.6% sequence identity) suggests a conserved central cavity for substrate binding and catalysis . Critical residues for activity (e.g., Arg143 and Arg239 in E. coli) are likely conserved in P. aeruginosa Lgt, facilitating diacylglyceryl transfer .

Functional Role in Lipoprotein Biogenesis

Lgt performs the first of three enzymatic steps in lipoprotein maturation:

  1. Diacylglyceryl transfer: Attaches a diacylglyceryl group from phosphatidylglycerol to the cysteine thiol of prolipoproteins .

  2. Substrate specificity: Recognizes the lipobox motif ([LVI][ASTVI][GAS]C) in prolipoproteins .

  3. Essentiality: Genetic depletion of lgt in E. coli and Acinetobacter baumannii leads to outer membrane destabilization, increased antibiotic sensitivity, and bactericidal effects . While direct evidence in P. aeruginosa is limited, its structural and functional conservation implies similar essentiality .

Enzymatic Activity and Assays

Key biochemical features:

  • Reaction by-product: Releases glycerol phosphate (G1P/G3P) during diacylglyceryl transfer .

  • In vitro assays: Utilize synthetic lipobox-containing peptides (e.g., Pal-IAAC) and detect glycerol phosphate via coupled luciferase reactions or mass spectrometry .

  • Inhibitor screening: Compounds like G9066 and G2824 inhibit E. coli Lgt (IC<sub>50</sub> values in nM range) and show bactericidal activity against P. aeruginosa .

Antibacterial Target Potential

Lgt is a promising target for novel antibiotics due to:

  • Bactericidal effects: Partial inhibition (~25% depletion) suffices to kill E. coli and sensitize it to serum complement .

  • Resistance mitigation: Unlike downstream lipoprotein pathway inhibitors (e.g., globomycin), Lgt inhibitors remain effective even in strains lacking major outer membrane lipoprotein Lpp .

  • Structural insights: Crystal structures of E. coli Lgt with phosphatidylglycerol and palmitic acid provide a blueprint for rational drug design .

Research Applications

  • Drug discovery: Recombinant P. aeruginosa Lgt enables high-throughput screening of inhibitors targeting lipoprotein biosynthesis .

  • Pathogenesis studies: Investigating Lgt’s role in P. aeruginosa virulence, including biofilm formation and antibiotic resistance .

  • Structural biology: Homology modeling supports mechanistic studies of substrate recognition and catalysis .

Outstanding Questions and Challenges

  • Species-specific variations: Functional differences between P. aeruginosa Lgt and homologs in other bacteria remain underexplored.

  • In vivo validation: Most inhibitor data derive from E. coli; efficacy in P. aeruginosa requires direct testing.

  • Resistance mechanisms: Whether P. aeruginosa can develop resistance to Lgt inhibitors via mutations or efflux pumps is unknown.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
lgt; PSPA7_0434; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain PA7)
Target Names
lgt
Target Protein Sequence
MLTYPQIDPVALAIGPLKIHWYGLMYLIGIGGAWLLASRRMKRFDPSWTKERLSDLVFWV ACGVILGGRLGYVLFYNLDEYIANPTLIFEVWKGGMSFHGGLLGVMLAVWWFGKRHGKSF FQLMDFIAPLVPIGLGAGRIGNFINSELWGKVSDVPWAMVFPNGGPLPRHPSQLYQFALE GVALFVILWLFTRKPRPTASVSGLFVLCYGIFRFVVEFVRVPDAQLGYLAWGWLTMGQVL CVPMVLAGIALMVWAYRRDAAQPKAA
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) is an enzyme that catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the maturation process of lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of prolipoprotein diacylglyceryl transferase (lgt) in Pseudomonas aeruginosa?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential enzyme in Pseudomonas aeruginosa and other Gram-negative bacteria that catalyzes the first step in bacterial lipoprotein biosynthesis. The enzyme transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox of prolipoproteins, which is crucial for proper membrane anchoring of bacterial lipoproteins . This post-translational modification is essential for bacterial viability, as mutations in the lgt gene are lethal in Escherichia coli and other Gram-negative organisms . The lethality of lgt mutations underscores its critical role in maintaining bacterial cell envelope integrity and function.

How does lgt contribute to Pseudomonas aeruginosa pathogenicity?

Lgt plays an indirect but significant role in Pseudomonas aeruginosa pathogenicity by enabling the proper processing and localization of numerous lipoproteins involved in virulence. While not directly implicated in virulence like the LasR quorum sensing system, the lipoproteins processed by lgt can contribute to bacterial adhesion, biofilm formation, and immune evasion . Pseudomonas aeruginosa is known to cause serious lung infections, particularly in individuals with chronic lung conditions such as bronchiectasis, with approximately 25% of bronchiectasis patients developing chronic Pseudomonas infections . The proper functioning of membrane-associated virulence factors, many of which are lipoproteins processed by lgt, is crucial for the bacterium's ability to establish and maintain these infections.

What expression systems are commonly used for recombinant Pseudomonas aeruginosa lgt production?

Recombinant Pseudomonas aeruginosa lgt can be expressed using several systems, with E. coli being the most common heterologous host. For expression, researchers typically employ complementation strategies where the native lgt gene is deleted from the host chromosome and complemented with the Pseudomonas-derived lgt gene provided in trans . Temperature-sensitive plasmids can be utilized for controlled expression, allowing cell growth at permissive temperatures (e.g., 30°C) but not at restrictive temperatures (e.g., 37°C) . This approach creates a selection system that ensures maintenance of the expression plasmid without antibiotic pressure. Both soluble proteins and those forming inclusion bodies can be successfully expressed using this system, making it versatile for different research applications involving recombinant Pseudomonas aeruginosa lgt .

How can I establish an lgt-based selection system for stable maintenance of expression plasmids?

To establish an lgt-based selection system for stable plasmid maintenance without antibiotics, follow this methodological approach:

  • Chromosomal deletion: Delete the native lgt gene from your host organism (e.g., E. coli) using precise genome editing techniques such as CRISPR-Cas9 or λ-Red recombineering.

  • Complementation plasmid construction: Construct a temperature-sensitive complementation plasmid carrying the Pseudomonas aeruginosa lgt gene that allows cell growth at 30°C but not at 37°C.

  • Expression vector development: Create a temperature-insensitive expression vector carrying the P. aeruginosa lgt gene along with your gene of interest.

  • Transformation and selection: Transform your lgt-deleted strain containing the temperature-sensitive complementation plasmid with your expression vector, and select transformants by growth at 39°C .

This approach forces cells to maintain the expression plasmid since losing it would be lethal due to the absence of the essential lgt gene in the chromosome . The system confers extreme stability on expression plasmids without requiring antibiotics, which is advantageous for large-scale protein production and reduces concerns about antibiotic resistance gene spread and antibiotic residues in final products .

What are the optimal conditions for assessing lgt enzyme activity in vitro?

The optimal conditions for assessing Pseudomonas aeruginosa lgt activity in vitro involve a carefully designed enzymatic assay system:

  • Substrate preparation: Utilize synthetic peptides containing the conserved lipobox motif (typically [LVI][ASTVI][GAS][C]) with a fluorescent or radioactive tag attached to the cysteine residue.

  • Reaction conditions: Conduct reactions in buffer systems containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, and 0.1% Triton X-100 with 1-2 mM phosphatidylglycerol as the diacylglyceryl donor.

  • Detection methods: Monitor the transfer of the diacylglyceryl group to the cysteine residue of the peptide substrate using techniques such as thin-layer chromatography, mass spectrometry, or fluorescence-based assays.

  • Kinetic analysis: Determine enzyme kinetics by varying substrate concentrations and measuring initial reaction rates at optimal temperature (typically 30-37°C).

Alternative approaches include complementation assays where the ability of recombinant lgt to restore growth in lgt-deficient bacterial strains can be used as a functional readout of enzyme activity . This is particularly useful when direct enzymatic assays are technically challenging.

How can I monitor the stability of recombinant lgt expression plasmids over multiple generations?

To monitor the stability of recombinant lgt expression plasmids over multiple generations, implement this methodological approach:

  • Serial passaging: Grow cultures for 24 hours at 37°C in liquid medium without antibiotic selection, then dilute 1:200 into fresh medium and repeat for desired number of generations (typically 20-100 generations).

  • Quantitative assessment: At regular intervals (e.g., every 10 generations), plate diluted cultures on non-selective media and use colony PCR or replica plating to determine the percentage of cells that retain the plasmid.

  • Phenotypic verification: For lgt-complementation systems, compare growth at permissive versus non-permissive temperatures to confirm functional maintenance of the lgt gene .

  • Expression verification: Periodically assess expression levels of lgt and your protein of interest through techniques such as Western blotting or enzyme activity assays.

This approach allows for quantitative assessment of plasmid stability without antibiotic selection pressure. Using the lgt complementation system, plasmid stability can exceed 99.9% even after 100 generations of growth without selection, making it significantly more stable than traditional antibiotic-based selection systems .

How can lgt be utilized as a target for novel antimicrobial development against Pseudomonas aeruginosa?

Lgt represents a promising target for novel antimicrobial development against Pseudomonas aeruginosa due to its essential nature and conservation across Gram-negative bacteria. A comprehensive research approach would include:

  • Structure-based drug design: Determine the crystal structure of Pseudomonas aeruginosa lgt to identify potential binding pockets for small-molecule inhibitors. Focus on regions that interact with either the prolipoprotein substrate or the phosphatidylglycerol donor.

  • High-throughput screening: Develop miniaturized assays for lgt activity amenable to high-throughput screening of chemical libraries to identify inhibitor candidates.

  • Rational design of substrate analogs: Design competitive inhibitors based on the structure of the natural substrates (prolipoproteins or phosphatidylglycerol).

  • Validation in cellular systems: Test promising compounds in lgt-complementation systems where inhibition of lgt would lead to growth arrest.

The advantage of targeting lgt is its essentiality in Gram-negative bacteria, which means resistance development would be challenging since the gene cannot be simply deleted . Additionally, the absence of a mammalian homolog reduces the likelihood of host toxicity. The widespread antibiotic resistance in Pseudomonas aeruginosa, particularly in chronic lung infections, makes new antimicrobial targets especially valuable .

What is the role of lateral genetic transfer in the evolution of lgt variants in Pseudomonas aeruginosa?

Lateral genetic transfer (LGT) likely plays a significant role in the evolution of lgt variants in Pseudomonas aeruginosa, though this specific interaction hasn't been thoroughly characterized. Based on research on phage-host interactions:

  • Mechanism of acquisition: Pseudomonas aeruginosa can acquire genetic material, including potentially modified versions of genes like lgt, through various mechanisms of lateral gene transfer mediated by bacteriophages, conjugation, or natural transformation .

  • Evidence from related systems: Studies using genetic recombination detection algorithms (implemented in tools like SplitsTree and RDP4) have demonstrated LGT between Pseudomonas phages and their hosts, with strong statistical support (bootstrap values: 91.3-100; fit: 91.433-100) .

  • Functional implications: LGT events typically involve genes encoding hypothetical proteins, which could include variants of essential genes like lgt with modified substrate specificity or regulation .

  • Co-evolutionary trajectories: Phage-prophage interactions mediated by LGT can have far-reaching impact on the co-evolutionary trajectories of bacteria and their viruses, potentially affecting essential genes like lgt when present in microbially rich environments .

These evolutionary mechanisms could generate lgt variants with altered substrate specificity or regulation, potentially contributing to bacterial adaptation to different environments or hosts.

How does lgt function coordinate with other lipoprotein processing enzymes in Pseudomonas aeruginosa?

Lgt functions as part of a coordinated lipoprotein processing pathway in Pseudomonas aeruginosa, working sequentially with other enzymes:

  • Processing sequence: Lgt catalyzes the first step by transferring a diacylglyceryl moiety to the conserved cysteine. Subsequently, lipoprotein signal peptidase II (LspA) cleaves the signal peptide at the modified cysteine, and lipoprotein N-acyltransferase (Lnt) adds a third acyl chain to the amino group of the cysteine residue.

  • Spatial organization: These enzymes are likely spatially organized in the inner membrane to facilitate efficient sequential processing of prolipoproteins. The precise spatial relationships remain an area of active investigation.

  • Regulatory coordination: Expression of lgt and other lipoprotein processing enzymes is likely coordinated through shared regulatory networks to ensure appropriate stoichiometry.

  • Substrate channeling: Evidence suggests possible substrate channeling mechanisms where lipoprotein intermediates are directly transferred between processing enzymes without release into the membrane.

Research methodologies to investigate these interactions include co-immunoprecipitation, bacterial two-hybrid assays, and fluorescence resonance energy transfer (FRET) to detect protein-protein interactions among the lipoprotein processing enzymes. Genetic approaches can also reveal synthetic phenotypes when combining partial loss-of-function mutations in multiple pathway components.

What strategies can overcome low expression or insolubility of recombinant Pseudomonas aeruginosa lgt?

When encountering low expression or insolubility of recombinant Pseudomonas aeruginosa lgt, implement these strategic approaches:

StrategyImplementationExpected Outcome
Codon optimizationAdjust codons to match host preference without altering protein sequenceImproved translation efficiency
Fusion partnersAdd solubility tags (MBP, SUMO, or TrxA) to N-terminus with cleavable linkerEnhanced solubility and expression
Expression temperatureLower growth temperature to 16-25°C after inductionReduced aggregation and increased proper folding
Membrane mimeticsInclude detergents or lipids in lysis and purification buffersBetter solubilization of this membrane-associated enzyme
Host strain selectionTest expression in membrane protein-specialized strains (C41/C43)Improved handling of membrane protein overexpression

For validation of these strategies, monitor expression levels using Western blot analysis with antibodies specific to Pseudomonas aeruginosa lgt or to an epitope tag engineered into the recombinant protein. Assess enzyme activity using the complementation approach, where the ability of the recombinant protein to restore growth in an lgt-deletion strain provides functional validation .

How can I differentiate between wild-type and recombinant lgt activity in experimental settings?

Differentiating between wild-type and recombinant lgt activity requires carefully designed experimental approaches:

  • Epitope tagging: Engineer recombinant lgt with a small epitope tag (His, FLAG, or HA) that doesn't interfere with enzyme function but allows specific detection and immunoprecipitation.

  • Species-specific antibodies: Develop antibodies that specifically recognize Pseudomonas aeruginosa lgt but not the host's native enzyme, exploiting sequence differences between bacterial species.

  • Genetic knockout systems: Utilize complete lgt knockout strains complemented with recombinant lgt, ensuring all detected activity comes solely from the recombinant enzyme .

  • Substrate specificity analysis: Exploit potential differences in substrate preference between wild-type and recombinant enzymes using synthetic peptides with systematic variations in the lipobox sequence.

  • Temperature sensitivity: If the recombinant lgt originates from a species with different temperature optima than the host, conduct assays at temperatures where activities can be distinguished.

The genetic complementation approach offers the most definitive differentiation, as demonstrated in systems where the E. coli lgt gene was deleted and complemented with the corresponding gene from Vibrio cholerae . This system ensures that all lgt activity must come from the recombinant enzyme.

What quality control measures should be implemented when purifying recombinant lgt for structural studies?

Rigorous quality control measures are essential when purifying recombinant Pseudomonas aeruginosa lgt for structural studies:

  • Purity assessment: Employ multiple orthogonal techniques including SDS-PAGE with silver staining (target >95% purity), size-exclusion chromatography to confirm monodispersity, and mass spectrometry to verify protein identity and detect potential modifications.

  • Functional validation: Confirm enzyme activity using in vitro assays measuring diacylglyceryl transfer to synthetic peptide substrates or through complementation of lgt-deficient strains .

  • Structural integrity: Utilize circular dichroism spectroscopy to assess secondary structure content and thermal stability, ensuring the purified protein maintains its native fold.

  • Homogeneity analysis: Perform dynamic light scattering to evaluate sample homogeneity and detect aggregation, crucial for crystallization success.

  • Detergent evaluation: For this membrane protein, carefully optimize detergent type and concentration using fluorescence-based thermal stability assays to identify conditions that maintain native structure while allowing crystallization.

Implementing these quality control measures significantly increases the likelihood of successful structural studies by ensuring the recombinant lgt sample is pure, homogeneous, properly folded, and enzymatically active. Document detergent exchange procedures thoroughly, as detergent choice critically affects membrane protein crystallization outcomes.

How does lgt activity in Pseudomonas aeruginosa change during different phases of biofilm formation?

Lgt activity in Pseudomonas aeruginosa likely undergoes significant changes during different phases of biofilm formation, though this relationship hasn't been directly characterized. A comprehensive investigation would require:

  • Expression analysis: Utilize quantitative RT-PCR and proteomics to measure lgt expression levels during planktonic growth, attachment, microcolony formation, maturation, and dispersion phases of biofilm development.

  • Activity profiling: Develop reporter systems using fluorescently tagged lipoprotein substrates to monitor lgt activity in real-time during biofilm formation.

  • Conditional mutants: Create conditional lgt mutants using inducible promoters to determine the consequences of lgt depletion at different biofilm stages.

  • Spatial analysis: Implement fluorescence microscopy with activity-based probes to visualize lgt activity distribution within three-dimensional biofilm structures.

The hypothesis is that lgt activity likely increases during early biofilm formation when numerous adhesins and surface-associated proteins (many of which are lipoproteins) are required for attachment and microcolony formation. During chronic infections, such as those occurring in bronchiectasis patients, Pseudomonas aeruginosa forms biofilms that contribute to antibiotic resistance and persistent infection . Understanding how lgt activity changes during biofilm formation could provide insights into potential therapeutic interventions.

What is the relationship between lgt function and antibiotic resistance in clinical Pseudomonas aeruginosa isolates?

The relationship between lgt function and antibiotic resistance in clinical Pseudomonas aeruginosa isolates represents an important research area:

  • Lipoproteins in resistance: Many antibiotic resistance mechanisms involve lipoproteins processed by lgt, including components of efflux pumps, β-lactamases, and outer membrane modification systems.

  • Clinical correlation studies: Analyze lgt sequence variants and expression levels in resistant versus susceptible clinical isolates, particularly from chronic infections such as those in bronchiectasis patients where approximately 25% develop chronic Pseudomonas infections with increased resistance .

  • Conditional expression experiments: Use controlled expression of lgt to determine how altered lipoprotein processing affects minimum inhibitory concentrations (MICs) for various antibiotic classes.

  • Lipidomic analysis: Investigate whether altered lgt activity affects membrane lipid composition, which can influence antibiotic penetration and efflux pump function.

Pseudomonas aeruginosa infections are particularly difficult to treat due to intrinsic and acquired antibiotic resistance mechanisms . Since lgt processes numerous lipoproteins involved in maintaining membrane integrity and function, subtle alterations in its activity could have widespread effects on antibiotic susceptibility. Research methodologies would include gene expression analysis, lipidomic profiling, and antimicrobial susceptibility testing of clinical isolates with characterized lgt variants.

How can lgt-based selection systems be optimized for large-scale production of therapeutic proteins?

Optimizing lgt-based selection systems for large-scale therapeutic protein production requires addressing several critical parameters:

  • Plasmid copy number optimization: Engineer plasmid backbones with precisely controlled copy numbers that balance expression levels with metabolic burden. Lower copy numbers often provide more stable long-term expression for large-scale production.

  • Induction system refinement: Develop tightly regulated induction systems compatible with the lgt selection mechanism. Temperature-insensitive expression vectors carrying the lgt gene can be constructed for controlled expression of therapeutic proteins .

  • Process scale-up considerations: Implement fed-batch cultivation strategies that maintain selection pressure without the need for antibiotics, potentially using the temperature-sensitivity of complementation plasmids as a selective mechanism .

  • Host strain engineering: Create production strains with additional genomic modifications that complement the lgt selection system, such as deletion of proteases or optimization of secretion pathways.

  • Protein-specific optimizations: For secreted therapeutic proteins like cholera toxin B subunit (CTB), which has been successfully produced using lgt-based systems, optimize signal sequences and periplasmic folding conditions .

The lgt-based selection system described in the literature has been successfully used to produce both soluble proteins and those forming inclusion bodies, demonstrating its versatility . This system's advantage lies in conferring extreme stability on expression plasmids without requiring antibiotics, which is particularly valuable for therapeutic protein production where antibiotic residues must be eliminated from final products .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.