Recombinant Pseudomonas aeruginosa Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant HtpX refers to the genetically engineered form of the HtpX protease derived from P. aeruginosa, a Gram-negative opportunistic pathogen. This zinc metalloprotease localizes to the cytoplasmic membrane and participates in protein quality control by degrading misfolded or stress-damaged membrane proteins . Its recombinant form enables standardized study of its structure-function relationships and therapeutic potential.

Key characteristics:

  • UniProt ID: A6V3R0 (strain PA7)

  • EC Number: 3.4.24.- (uncharacterized metalloprotease activity)

  • Gene Locus: PSPA7_2325 in P. aeruginosa PA7

Functional Roles in Antibiotic Resistance

HtpX contributes to intrinsic aminoglycoside resistance by degrading misfolded membrane proteins caused by antibiotic-induced translational errors . Key findings include:

Table 1: Impact of HtpX Inactivation on Tobramycin Sensitivity

StrainTobramycin MIC (μg/ml)Fold Change vs. Wild TypeSource
Wild-type P. aeruginosa0.5-
htpX mutant0.25–0.1252–4× reduction
htpX/clpA double mutant4–816–32× reduction

Synergistic effects occur when HtpX is combined with other protease mutations (e.g., clpA, ftsH), amplifying aminoglycoside sensitivity up to 500-fold .

Mechanistic Insights

  • Proteolytic Redundancy: HtpX overlaps functionally with FtsH and ClpA proteases, forming a robust network to eliminate cytotoxic protein aggregates .

  • Regulation: Expression is controlled by the AmgRS two-component system, which activates htpX under membrane stress .

  • Substrate Specificity: Preferentially degrades hydrophobic, misfolded membrane proteins generated during aminoglycoside-induced mistranslation .

Key Research Findings

  1. Genetic Interaction Networks:

    • Inactivation of htpX, yccA, and PA5528 reduces tobramycin MICs synergistically (32-fold vs. wild type) .

    • Complementation with plasmid-borne htpX partially restores antibiotic resistance in triple mutants .

  2. Cross-Species Conservation:

    • E. coli HtpX shares functional overlap with FtsH, suggesting evolutionary conservation of membrane protein quality control .

  3. Stress Response:

    • HtpX is critical for resistance to NaCl, alkaline pH, and membrane-damaging agents beyond aminoglycosides .

Limitations and Future Directions

  • Structural Data: No crystallographic or cryo-EM structures of HtpX are available, limiting mechanistic studies.

  • Therapeutic Targeting: Redundancy with FtsH/ClpA necessitates multi-protease inhibition for effective adjuvant strategies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; PSPA7_2325; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain PA7)
Target Names
htpX
Target Protein Sequence
MMRILLFLATNLAVLVIASITLKLLGVDRFTGQNYGSLLVFCAVFGFAGSLVSLFISKWM AKMSTGTEVISQPRTRHEQWLLQTVEELSREAGIKMPEVGIFPAYEANAFATGWNKNDAL VAVSQGLLERFSPDEVKAVLAHEIGHVANGDMVTLALIQGVVNTFVMFFARIFGNFVDKA ILKNEDGPGIGYFVATIFAELVLGILASIIVMWFSRRREFRADAAGAHLAGTGAMIAALQ RLRSEQGVPVQMPDTLNAFGINGGLKHGLAGLLMSHPPLEDRIEALRASAR
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas aeruginosa Protease HtpX and what is its primary function?

HtpX is a membrane-bound protease in Pseudomonas aeruginosa that plays a crucial role in intrinsic aminoglycoside resistance. It functions as part of a proteolytic network that protects the bacterial cell from the disruptive effects of aminoglycoside antibiotics. Structurally, HtpX is anchored in the cytoplasmic membrane, where it participates in the degradation of misfolded or damaged membrane proteins that could otherwise compromise membrane integrity .

The primary function of HtpX appears to be the elimination of membrane-disruptive polypeptides that result from translational misreading caused by aminoglycoside antibiotics. This protective mechanism helps maintain membrane barrier function even in the presence of these antibiotics .

How does HtpX contribute to aminoglycoside resistance in P. aeruginosa?

HtpX contributes to aminoglycoside resistance through several mechanisms:

  • It removes misfolded membrane proteins that result from aminoglycoside-induced translational errors

  • It works cooperatively with other proteases (particularly FtsH) to maintain membrane integrity

  • It is upregulated as part of the AmgRS-mediated stress response to aminoglycoside exposure

Genetic studies have demonstrated that inactivation of the htpX gene increases tobramycin sensitivity in P. aeruginosa. While a single htpX mutation shows only modest effects on aminoglycoside sensitivity, when combined with mutations in other protective genes (particularly yccA and PA5528), there is a synergistic increase in sensitivity - up to 32-fold lower MIC compared to wild-type strains .

What regulatory systems control HtpX expression in P. aeruginosa?

HtpX expression in P. aeruginosa is primarily regulated by the AmgRS two-component system. AmgRS functions as an envelope stress response regulator similar to the CpxRA system in Escherichia coli. When P. aeruginosa encounters aminoglycoside antibiotics, the AmgRS system is activated, leading to increased expression of several protective genes, including htpX .

Experimental data shows that htpX exhibits the greatest AmgRS-dependent expression among the genes studied. In amgRS deletion mutants, the basal expression of htpX is significantly reduced, contributing to the increased aminoglycoside sensitivity observed in these strains .

How does HtpX functionally relate to other proteases in P. aeruginosa?

HtpX functions within a network of proteases that collectively contribute to aminoglycoside resistance:

Protease/FactorRelationship to HtpXFunction in Resistance
FtsHParallel/complementary functionPrimary membrane protease for removing disruptive polypeptides
YccAModulates FtsH activityRegulates FtsH-mediated proteolysis
HslVUComplementary functionCytoplasmic ATP-dependent protease
HflK/HflCIndirect relationshipFtsH accessory factors

HtpX appears to have partially overlapping functions with FtsH, as observed in E. coli where double mutants lacking both proteases exhibit synthetic growth defects. In P. aeruginosa, HtpX may perform redundant back-up functions for FtsH or act on disruptive polypeptides that FtsH does not recognize .

What experimental approaches are most effective for studying recombinant HtpX expression and purification?

For effective recombinant HtpX expression and purification, researchers should consider:

  • Expression system selection: Given HtpX's membrane-bound nature, expression systems that handle membrane proteins effectively should be prioritized. E. coli BL21(DE3) with specific vectors containing tags that aid solubility (such as MBP or SUMO) can improve yield.

  • Induction conditions optimization: For membrane proteins like HtpX:

    • Lower temperatures (16-25°C)

    • Reduced IPTG concentrations (0.1-0.5 mM)

    • Extended induction periods (12-18 hours)

  • Membrane protein extraction: Use of specialized detergents such as n-dodecyl-β-D-maltoside (DDM), CHAPS, or digitonin that maintain structural integrity of membrane proteins.

  • Purification strategy: A multi-step approach:

    • Initial purification via affinity chromatography (using His-tag)

    • Secondary purification via ion exchange or size exclusion chromatography

    • Activity verification at each purification step

When isolating active recombinant HtpX, maintaining the native conformation is critical. Researchers should validate purified HtpX activity using substrate degradation assays before proceeding to functional studies .

How can researchers effectively generate and analyze htpX mutants to study antimicrobial resistance?

To effectively generate and analyze htpX mutants:

  • Mutation strategies:

    • Targeted deletion using homologous recombination techniques

    • Cre-loxP recombination system for marker-free mutations

    • Transposon insertions for initial screening followed by precise genetic modification

  • Construction of multiple mutants: An iterative technique involving phage lambda red recombination can be employed, as demonstrated in studies where htpX mutations were combined with other protease gene mutations. This approach revealed synergistic effects between htpX, PA5528, and yccA mutations .

  • Phenotypic analysis:

    • Determination of Minimum Inhibitory Concentrations (MICs) for aminoglycosides on standardized media (LB-MOPS at pH 7.6)

    • Growth curve analysis in sub-inhibitory antibiotic concentrations

    • Membrane integrity assays to assess the functional consequences of htpX inactivation

  • Complementation testing: Plasmid-based expression of wild-type htpX in mutant strains should be performed to confirm phenotypic effects are directly attributable to htpX inactivation .

What synergistic effects are observed when htpX mutations are combined with other protease gene mutations?

When htpX mutations are combined with other protease gene mutations, significant synergistic effects on aminoglycoside sensitivity are observed:

Mutant CombinationTobramycin MIC (μg/ml)Fold Reduction vs. Wild-type
Wild-type0.51x
htpX single mutant0.51x
PA5528 single mutant0.252x
yccA single mutant0.252x
htpX-PA5528 double mutant0.1254x
htpX-yccA double mutant0.1254x
PA5528-yccA double mutant0.0638x
htpX-PA5528-yccA triple mutant0.01632x
ΔamgRS0.03116x

The triple mutant (htpX-PA5528-yccA) demonstrates extreme sensitivity to tobramycin, with MIC values 32-fold lower than the wild-type and 2-fold lower than the amgRS deletion mutant. This suggests that these three genes provide partially redundant protection mechanisms against aminoglycoside antibiotics .

The synergistic effects observed in multiple mutants indicate that HtpX functions as part of a broader network of proteases and resistance factors, with significant functional overlap between different components of this network .

How does the experimental design for studying HtpX differ between in vitro and in vivo approaches?

In vitro experimental approaches:

  • Substrate specificity determination:

    • Purified recombinant HtpX can be tested against various synthetic peptides or protein substrates

    • Use of fluorogenic or chromogenic substrates for kinetic analysis

    • Mass spectrometry to identify cleavage sites and preferences

  • Biochemical characterization:

    • Determination of optimal pH, temperature, and ionic conditions

    • Cofactor requirements assessment

    • Inhibitor profiling to identify specific modulators of activity

  • Structural studies:

    • X-ray crystallography or cryo-EM for structural determination

    • Site-directed mutagenesis to identify catalytic residues

    • Protein-protein interaction studies with potential partners like FtsH

In vivo experimental approaches:

  • Gene regulation studies:

    • Transcriptional reporter fusions to monitor htpX expression

    • ChIP-seq to identify direct binding of AmgRS to the htpX promoter

    • RNA-seq to examine global expression changes in htpX mutants

  • Physiological impact assessment:

    • Membrane integrity assays using fluorescent dyes

    • Aminoglycoside uptake measurements

    • Proteome analysis to identify accumulated proteins in htpX mutants

  • Infection models:

    • Animal infection models to assess virulence of htpX mutants

    • Mixed infection studies to determine fitness costs

    • Antibiotic efficacy testing in infection settings

The key difference is that in vitro approaches focus on the biochemical properties and direct activities of HtpX, while in vivo approaches examine its physiological role within the cellular context and its contribution to bacterial fitness and antibiotic resistance .

How can researchers effectively measure HtpX proteolytic activity in experimental settings?

To effectively measure HtpX proteolytic activity:

  • Direct proteolytic assays:

    • Fluorescence resonance energy transfer (FRET)-based peptide substrates

    • SDS-PAGE analysis of substrate degradation over time

    • Western blotting to track specific substrate proteins

  • Membrane-based activity assays:

    • Reconstitution of HtpX in liposomes or nanodiscs

    • Monitoring degradation of membrane-embedded substrates

    • Coupling with fluorescent reporters embedded in artificial membranes

  • Cellular assays:

    • Expression of tagged potential substrates

    • Pulse-chase experiments to track protein turnover

    • Proteomics approaches to identify accumulated substrates in htpX mutants

  • Activity controls and validation:

    • Site-directed mutagenesis of catalytic residues as negative controls

    • Comparison with known protease inhibitors

    • Complementation with wild-type htpX to confirm activity

For accurate measurement, researchers should account for the membrane-bound nature of HtpX by ensuring appropriate detergent conditions that maintain protein structure while allowing access to substrates. Additionally, as HtpX activity may be influenced by other factors (like FtsH), experimental designs should incorporate appropriate controls to distinguish direct HtpX activity from effects of interacting proteins .

How might understanding HtpX function contribute to novel antimicrobial strategies?

Understanding HtpX function could contribute to novel antimicrobial strategies through several approaches:

  • Direct HtpX inhibition: Developing specific inhibitors of HtpX could potentially sensitize P. aeruginosa to aminoglycosides. The synergistic effects observed when multiple proteases are inactivated suggest that protease inhibition could be a viable strategy for enhancing aminoglycoside efficacy .

  • Combination therapy: The research showing that HtpX deletion increases sensitivity to multiple antibiotic classes suggests that HtpX inhibitors could potentially serve as adjuvants to existing antibiotics, allowing lower doses or overcoming resistance .

  • Membrane stress targeting: Since HtpX appears to protect against membrane disruption, compounds that increase membrane stress could potentially synergize with aminoglycosides in htpX-deficient strains.

  • AmgRS pathway modulation: As HtpX is regulated by AmgRS, targeting this regulatory pathway could downregulate multiple resistance mechanisms simultaneously, potentially creating a more pronounced sensitization effect than targeting individual components .

Research methodologies for these applications would include high-throughput screening for inhibitors, in silico modeling of HtpX structure for rational drug design, and combination testing of potential inhibitors with various antibiotic classes .

What are the current technical limitations in studying recombinant HtpX and how might they be overcome?

Current technical limitations in studying recombinant HtpX include:

  • Membrane protein expression challenges:

    • Limited yield due to toxicity or aggregation

    • Potential solution: Use of specialized expression systems such as C43(DE3) E. coli strains designed for membrane proteins or cell-free expression systems

  • Maintaining native conformation:

    • Difficulty preserving proteolytic activity during purification

    • Potential solution: Nanodiscs or amphipol technologies that better mimic the native membrane environment

  • Structural characterization difficulties:

    • Challenges in crystallizing membrane proteins

    • Potential solution: Cryo-EM approaches or the use of truncated soluble domains for initial structural studies

  • Substrate identification:

    • Uncertainty about physiological substrates

    • Potential solution: Proteomic approaches comparing wild-type and htpX mutant membrane proteomes, possibly with crosslinking to capture transient enzyme-substrate interactions

  • Activity measurement standardization:

    • Lack of standardized assays for membrane proteases

    • Potential solution: Development of reporter substrates specifically designed for membrane-embedded proteases

These limitations can be addressed through interdisciplinary approaches combining structural biology, biochemistry, and molecular genetics techniques specifically adapted for membrane proteins .

What is the evolutionary significance of HtpX conservation across bacterial species?

The evolutionary conservation of HtpX across bacterial species suggests it plays a fundamental role in bacterial physiology beyond P. aeruginosa-specific functions:

  • Functional conservation: The overlapping functions of HtpX with FtsH observed in both P. aeruginosa and E. coli indicate a conserved role in membrane protein quality control across diverse bacterial species .

  • Stress response integration: HtpX appears to be part of core stress response mechanisms that help bacteria adapt to environmental challenges, including antibiotic exposure.

  • Redundancy and robustness: The presence of overlapping proteolytic systems (HtpX, FtsH, HslVU) suggests evolutionary pressure to maintain robust membrane quality control through redundancy.

Research on the evolutionary aspects of HtpX would benefit from:

  • Comparative genomics approaches examining htpX sequence conservation and synteny

  • Functional complementation studies testing whether htpX from different species can restore aminoglycoside resistance in P. aeruginosa htpX mutants

  • Phylogenetic analysis of membrane proteases to understand their evolutionary relationships

Understanding the evolutionary context of HtpX could provide insights into fundamental aspects of bacterial physiology and potentially identify conserved features that might be targeted in broad-spectrum antimicrobial approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.