Recombinant Pseudomonas aeruginosa Protein CysZ homolog (cysZ)

What is CysZ and what is its role in bacterial physiology?

CysZ belongs to a family of 28-30 kDa bacterial inner-membrane proteins found exclusively in prokaryotes with no apparent homology to other known protein families. In Pseudomonas aeruginosa, the CysZ protein (encoded by gene PA0846) functions as a sulfate transporter, facilitating cellular uptake of sulfate ions across the bacterial membrane. This function makes it essential for sulfur metabolism, particularly in environments where sulfate availability may be limited. The protein plays a critical role in various cellular processes including amino acid synthesis and cellular defense mechanisms that rely on sulfur-containing compounds .

What are the structural characteristics of Pseudomonas aeruginosa CysZ?

The Pseudomonas aeruginosa CysZ protein consists of 246 amino acids with a molecular weight of approximately 28-30 kDa. Its primary sequence (MPALSGPQYLGEGLKLIMRPGLRLFVLIPLTLNLLVFALLIGFAMQQFSHWVDLLMPSLPDWLSFLQYIVWPLFVLLVLVIVFFTFTMVANIISAPFNGFLSEKVEVVVRGRDDFPPFSWAELLAMIPRTMGREMRKLAYFLPRALVLLVLSFVPGVNLIATPLWILFGIWMMAVQYIDYPADNHKLGWNEMLAWLRSKRWACMGFGGVTYLALLIPLVNLVMMPAAVAGATLFWVREEGERALVK) reveals a transmembrane protein with multiple helical domains that traverse the cytoplasmic membrane. Structural studies have demonstrated that CysZ forms oligomeric assemblies, typically organizing as dimers or hexamers, with an unusual inverted transmembrane arrangement where pairs of protomers form antiparallel dimers .

How does the recombinant version of P. aeruginosa CysZ differ from the native protein?

The recombinant version typically includes an N-terminal histidine tag (His-tag) to facilitate purification and detection, which is not present in the native protein. The commercially available recombinant full-length P. aeruginosa CysZ homolog protein (UniProt ID: Q9I595) encompasses all 246 amino acids (positions 1-246) of the native protein with the additional His-tag. This modification has minimal impact on the protein's fundamental structure and function but provides significant advantages for laboratory manipulation and analysis. The recombinant protein is typically expressed in E. coli expression systems rather than its native Pseudomonas context .

What are the optimal expression systems for producing recombinant P. aeruginosa CysZ?

E. coli remains the preferred expression system for recombinant P. aeruginosa CysZ due to its rapid growth, high yield potential, and compatibility with membrane protein expression. For research applications, BL21(DE3) or C41(DE3) strains are commonly employed, particularly when using the pET expression system with T7 promoters. These strains are specifically advantageous for membrane proteins like CysZ that may exhibit toxicity when overexpressed. The expression is typically induced with IPTG at concentrations between 0.1-0.5 mM when cultures reach OD600 of 0.6-0.8, followed by post-induction growth at lower temperatures (16-22°C) for 12-18 hours to enhance proper membrane insertion and folding .

What purification strategies yield the highest purity and activity for recombinant CysZ?

Purification of His-tagged CysZ requires a carefully optimized protocol that maintains protein stability throughout the process. After cell lysis (typically using sonication or pressure-based methods), membrane fractions are isolated by ultracentrifugation. The membrane-bound CysZ is then solubilized using detergents such as n-dodecyl-β-D-maltopyranoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations just above their critical micelle concentrations. Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin provides initial capture purification, followed by size exclusion chromatography to obtain homogeneous protein preparations. Throughout purification, maintaining the protein in buffers containing 150-300 mM NaCl, 20-50 mM Tris or HEPES (pH 7.5-8.0), and 0.02-0.05% detergent is crucial for stability. Purity greater than 90% can be achieved as determined by SDS-PAGE analysis .

How should the purified CysZ protein be handled and stored to maintain stability?

The purified recombinant CysZ protein is typically supplied as a lyophilized powder for maximum stability during shipping and long-term storage. For optimal preservation, the protein should be stored at -20°C to -80°C immediately upon receipt. Working aliquots should be prepared to avoid repeated freeze-thaw cycles, which significantly compromise protein integrity. For short-term studies (up to one week), aliquots can be stored at 4°C in appropriate buffer conditions. When reconstituting the protein, it is recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. For long-term storage of reconstituted protein, adding glycerol to a final concentration of 50% and storing in small aliquots at -20°C or -80°C is advisable. The storage buffer typically consists of a Tris/PBS-based solution with 6% trehalose at pH 8.0 to enhance stability .

What crystallization approaches have been successful for CysZ structural studies?

Successful crystallization of CysZ proteins has been achieved through structural genomics approaches involving screening multiple bacterial homologs. For P. aeruginosa CysZ, as well as homologs from other organisms (such as Idiomarina loihiensis and Pseudomonas fluorescens), vapor diffusion methods using sitting or hanging drops have proven effective. Typical crystallization conditions include PEG-based precipitants (PEG 400-8000) at concentrations of 10-30%, with buffers in the pH range of 6.0-8.5, and various salts (particularly lithium sulfate or ammonium sulfate at 0.1-0.3 M). The presence of specific detergents like n-dodecyl-N,N-dimethylamine-N-oxide (LDAO) or n-octyl-β-D-glucopyranoside (OG) at concentrations slightly above their CMCs is critical for maintaining protein stability during crystallization. Successful crystals have been obtained at temperatures ranging from 4°C to 20°C over periods of several days to weeks .

How can researchers validate the transmembrane assembly of CysZ observed in crystal structures?

Validation of CysZ's transmembrane assembly, particularly the unusual antiparallel arrangement observed in crystal structures, requires complementary experimental approaches beyond crystallography. Two particularly effective methods are:

• Disulfide crosslinking assays: By introducing cysteine mutations at strategic positions predicted to be in close proximity in the proposed structure (such as L161C-A164C in PfCysZ or V157C-Q163C in IlCysZ), researchers can perform disulfide trapping experiments. Formation of disulfide bonds between these engineered cysteines in isolated membranes confirms the predicted proximity relationships in the native membrane environment.

• Cysteine accessibility scanning: This approach involves creating single cysteine mutants at positions predicted to be accessible from different sides of the membrane based on the structural model. Labeling these mutants with membrane-impermeable fluorescent thiol-specific maleimide dyes helps determine which residues are exposed to the extracellular environment. For example, residues along helix H4 of IlCysZ that were predicted to be solvent-accessible were successfully labeled, confirming their extracellular exposure .

These complementary approaches provide powerful validation of the crystallographic models and help establish the true orientation and assembly of CysZ in its native membrane environment.

What roles do different crystallographic space groups play in revealing CysZ structural details?

The crystallization of CysZ proteins in different space groups has proven instrumental in revealing complementary structural information. For instance, IlCysZ crystals were obtained in space group C2 at 2.3 Å resolution, while PfCysZ also crystallized in space group C2 but diffracted to 3.5 Å. PdCysZ crystals formed in multiple space groups including P63, P4122, and P21, each providing distinct packing arrangements of the same fundamental architecture. The P63 and P21 lattices contained entire hexamers in their asymmetric units, while in the P4122 lattice, a molecular diad coincided with a crystallographic axis.

This diversity in crystal forms offers several advantages:

• Cross-validation of the observed oligomeric assemblies and interfaces

• Improved phase determination through different crystal symmetries

• Identification of conformational flexibility in different crystal packing environments

• Revelation of different functional states that may be captured by different crystal forms

The consistent observation of the same basic architecture across multiple space groups and organisms provides strong evidence for the biological relevance of the observed structures .

What experimental approaches can demonstrate the sulfate transport function of CysZ?

Several complementary experimental approaches can effectively characterize the sulfate transport function of CysZ:

• Radioisotope uptake assays: Using 35S-labeled sulfate to track transport in either whole cells expressing CysZ or in reconstituted proteoliposomes. This approach provides direct quantitative measurement of transport activity under various conditions.

• Growth complementation assays: Testing whether expression of P. aeruginosa CysZ can rescue growth of sulfate transport-deficient bacterial strains when sulfate is the sole sulfur source.

• Fluorescent sulfate analog studies: Employing fluorescent sulfate analogs to visualize and quantify transport activity in real-time using fluorescence microscopy or spectroscopy.

• Electrophysiology: For detailed biophysical characterization, patch-clamp or planar lipid bilayer recordings can determine if CysZ forms a channel or carrier-type transporter and reveal the kinetics and ion selectivity of transport.

These functional assays can be combined with site-directed mutagenesis of key residues (such as the conserved arginine residues implicated in sulfate binding) to establish structure-function relationships .

How can researchers identify and characterize the sulfate-binding sites in CysZ?

Identification and characterization of sulfate-binding sites in CysZ can be accomplished through several complementary approaches:

• Co-crystallization with sulfate or analogs: As demonstrated with IlCysZ, co-crystallization with sulfate (SO4^2-) or its heavier analog selenate (SeO4^2-) can directly visualize binding sites in the structure. The GLR(R) motif between helices H1 and H2 was identified as a key sulfate-binding site through this approach.

• Site-directed mutagenesis: Mutation of key residues implicated in sulfate binding (such as R27A/R28A in IlCysZ or the corresponding R25A in PfCysZ and R23A in PdCysZ) followed by functional assays can confirm the importance of specific residues in the binding process.

• Isothermal titration calorimetry (ITC): This technique can provide thermodynamic parameters of sulfate binding, including affinity constants, stoichiometry, and enthalpy changes.

• Microscale thermophoresis (MST): For studying the interaction of purified CysZ with sulfate under near-native conditions in detergent micelles.

Combining structural data with functional studies of wild-type and mutant proteins provides a comprehensive understanding of the sulfate recognition and binding mechanisms .

What approaches are effective for studying the oligomeric state of CysZ in membrane environments?

Understanding the oligomeric state of CysZ in membrane environments requires techniques that preserve native protein-protein interactions. Effective approaches include:

• Blue native PAGE: This technique separates protein complexes in their native state and can be used to analyze the oligomeric distribution of detergent-solubilized CysZ or membrane fractions containing CysZ.

• Size exclusion chromatography with multi-angle light scattering (SEC-MALS): This approach provides accurate molecular weight determination of membrane protein-detergent complexes, helping discriminate between different oligomeric states.

• Crosslinking studies: Chemical crosslinking (using agents like DSS or glutaraldehyde) or photo-crosslinking can capture transient protein-protein interactions in native membranes before extraction.

• Fluorescence resonance energy transfer (FRET): By labeling CysZ with appropriate fluorophore pairs, FRET can detect protein-protein proximity relationships in intact membranes or reconstituted systems.

• Electron microscopy: Single-particle cryo-EM or negative stain EM can visualize the oligomeric arrangement of purified CysZ complexes.

These techniques collectively provide a comprehensive picture of CysZ assembly in membrane environments, revealing whether it predominantly exists as dimers, hexamers, or other oligomeric forms under different physiological conditions .

How should researchers design experiments to investigate the structure-function relationship of CysZ?

Designing effective experiments to investigate structure-function relationships in CysZ requires a systematic approach that integrates multiple methodologies:

• Rational mutagenesis strategy: Based on available structural information, researchers should develop a comprehensive mutagenesis plan that targets:

  • Residues in predicted sulfate binding sites (particularly conserved arginine residues)

  • Amino acids at oligomeric interfaces

  • Residues lining potential transport pathways

  • Conserved motifs across CysZ homologs

• Functional readouts: Each mutant should be characterized with multiple functional assays to provide comprehensive assessment:

  • Sulfate uptake rates in intact cells and proteoliposomes

  • Binding affinity measurements for sulfate and analogs

  • Structural integrity verification (through techniques like circular dichroism or thermal stability assays)

• Correlation analysis: Statistical analysis should be performed to correlate structural features with functional parameters across multiple mutants, identifying key determinants of transport activity.

• Environmental variable testing: Experiments should systematically investigate how factors like pH, temperature, membrane composition, and ion gradients affect both wild-type and mutant CysZ function.

This integrated approach allows researchers to establish clear links between specific structural elements and functional capabilities of CysZ .

What considerations are important when designing proteoliposome reconstitution experiments for CysZ?

Proteoliposome reconstitution provides a controlled system for studying CysZ function, but requires careful experimental design:

• Lipid composition optimization:

  • Test multiple lipid compositions (including E. coli total lipid extracts, defined mixtures of phosphatidylcholine, phosphatidylethanolamine, and phosphatidylglycerol)

  • Consider inclusion of specific anionic lipids that might influence transporter function

  • Maintain consistent lipid-to-protein ratios (typically 50:1 to 200:1 by weight)

• Reconstitution method selection:

  • Detergent removal methods (using Bio-Beads, dialysis, or gel filtration) should be optimized for CysZ stability

  • Protein orientation in liposomes should be determined (using protease protection assays or antibody accessibility)

  • Size homogeneity should be verified by dynamic light scattering or electron microscopy

• Transport assay design:

  • Establish internal buffer compositions that allow detection of electrogenic transport (if present)

  • Include appropriate controls (protein-free liposomes, heat-inactivated protein)

  • Consider time-resolution of measurements to capture initial transport rates

• Data analysis approach:

  • Fit transport data to appropriate kinetic models (Michaelis-Menten or more complex models if allosterism is suspected)

  • Account for background permeability and non-specific binding

Properly designed proteoliposome experiments can provide quantitative insights into CysZ transport mechanisms that are impossible to obtain in more complex cellular systems .

What experimental controls are essential when studying CysZ variants through site-directed mutagenesis?

When investigating CysZ function through site-directed mutagenesis, several critical experimental controls are necessary:

• Expression level verification:

  • Western blot analysis to confirm comparable expression levels between wild-type and mutant proteins

  • Membrane fraction isolation to verify proper targeting and insertion

• Structural integrity controls:

  • Circular dichroism spectroscopy to confirm proper secondary structure

  • Thermal stability assays to detect potential destabilization caused by mutations

  • Size exclusion chromatography to verify oligomeric state preservation

• Functional baseline controls:

  • Empty vector controls in cellular assays

  • Proteoliposomes without protein for transport studies

  • Wild-type CysZ tested in parallel with each batch of mutants

  • Non-transported substrate analogs to distinguish binding from transport

• Mutagenesis strategy controls:

  • Conservative and non-conservative substitutions at the same position

  • Mutations in non-conserved, surface-exposed residues as negative controls

  • Rescue mutations that restore activity in non-functional mutants

These comprehensive controls ensure that observed functional differences are specifically attributed to the targeted structural features rather than artifacts of expression, folding, or assay conditions .

How can researchers investigate potential interactions between CysZ and other components of the sulfate assimilation pathway?

Investigating interactions between CysZ and other components of the sulfate assimilation pathway requires integrated molecular and cellular approaches:

• Co-immunoprecipitation studies: Using antibodies against CysZ or epitope-tagged versions to pull down protein complexes from solubilized membranes, followed by mass spectrometry identification of interacting partners.

• Bacterial two-hybrid systems: Adapted for membrane proteins, these genetic approaches can screen for interactions between CysZ and other components of the sulfate uptake and assimilation machinery.

• Proximity labeling techniques: Methods like BioID or APEX2, where a promiscuous biotin ligase is fused to CysZ, can identify proteins in close proximity within the cellular environment.

• Functional coupling assays: Measuring sulfate uptake rates in the presence of inhibitors or genetic knockouts of other pathway components can reveal functional dependencies.

• Co-localization studies: Using fluorescently labeled proteins to determine if CysZ co-localizes with other components of the sulfate assimilation pathway in bacterial cells.

These approaches collectively can map the protein interaction network around CysZ and provide insights into how sulfate transport is integrated with downstream metabolic processes .

What approaches can elucidate the regulation of CysZ expression and activity in Pseudomonas aeruginosa?

Understanding the regulation of CysZ requires investigation at multiple levels:

• Transcriptional regulation:

  • Promoter analysis using reporter gene fusions

  • Chromatin immunoprecipitation to identify transcription factors binding to the cysZ promoter

  • RNA-seq under varying sulfur availability conditions

  • Analysis of potential cis-regulatory elements in the promoter region

• Post-transcriptional regulation:

  • Analysis of mRNA stability and potential regulatory RNA interactions

  • Ribosome profiling to assess translation efficiency

• Post-translational regulation:

  • Phosphoproteomics to identify potential regulatory modifications

  • Analysis of protein stability under different growth conditions

  • Investigation of potential allosteric regulators through binding studies

• Environmental response characterization:

  • Systematic analysis of CysZ expression and activity under different sulfur sources

  • Investigation of cross-talk with other stress response pathways

  • Effects of biofilm formation on CysZ expression and function

These multimodal approaches can provide a comprehensive understanding of how P. aeruginosa regulates sulfate uptake through CysZ in response to environmental and metabolic signals .

How might structural information about CysZ inform the development of inhibitors targeting sulfate metabolism in pathogenic bacteria?

Structural insights into CysZ can guide rational approaches to inhibitor development through several strategies:

• Structure-based inhibitor design:

  • Virtual screening of compound libraries against the sulfate binding site

  • Fragment-based drug discovery focusing on the conserved GLR(R) motif

  • Design of peptidomimetics that could disrupt oligomeric assembly

• Mechanism-based inhibition strategies:

  • Development of substrate analogs that bind but are not transported

  • Compounds that lock the transporter in specific conformational states

  • Allosteric inhibitors that prevent conformational changes required for transport

• Validation approaches:

  • Co-crystallization of promising compounds with CysZ

  • Binding affinity measurements and structure-activity relationship studies

  • Cellular assays measuring inhibition of sulfate uptake and bacterial growth

  • Assessment of specificity against mammalian sulfate transporters

• Therapeutic potential assessment:

  • Testing in infection models to determine if CysZ inhibition attenuates virulence

  • Combination studies with existing antibiotics to detect potential synergies

  • Resistance development monitoring to assess the robustness of the approach

These approaches harness structural information to potentially develop novel therapeutics targeting an essential metabolic pathway in pathogenic bacteria like P. aeruginosa .