Recombinant Pseudomonas aeruginosa Protein-export membrane protein SecG (secG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
secG; PA4747; Protein-export membrane protein SecG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
secG
Target Protein Sequence
MLEKVVIVVHLLMALGLVGLILVQHGKGADAGASFGAGASATVFGSQGSATFLSRITGIL AAVFFLTSLGLAYFAKEKSDALQHIGLPDPAVLEQKQEKAPAADDVPVLQEQSKPAESAG DVPAAPEQK
Uniprot No.

Target Background

Function

Function: Involved in protein export and participates in an early stage of protein translocation.

Database Links

KEGG: pae:PA4747

STRING: 208964.PA4747

Protein Families
SecG family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is SecG and what role does it play in Pseudomonas aeruginosa protein export?

SecG is an integral membrane protein component of the Sec translocation machinery in P. aeruginosa. It functions as part of the SecYEG translocase complex, which forms the central channel for protein translocation across the cytoplasmic membrane. The Sec pathway facilitates the majority of protein transport through this membrane, with SecG specifically enhancing translocation efficiency through membrane topology inversion during protein passage .

The Sec machinery in P. aeruginosa is essential for exporting many virulence factors and other proteins to noncytoplasmic localizations. While SecG is not absolutely required for viability in all conditions (unlike SecY), it significantly improves translocation efficiency, particularly under stress conditions. In P. aeruginosa, this system is especially important given that approximately 38% of the proteome contains export signals such as N-terminal signal peptides .

How is SecG structurally and functionally conserved across bacterial species?

When comparing P. aeruginosa SecG to E. coli SecG, researchers have noted differences in binding affinities and interactions with other Sec components. For instance, the interaction between SecA and the SecYEG complex shows differences between the species, as evidenced by the observation that P. aeruginosa SecA (PaSecA) has different biochemical properties compared to E. coli SecA (EcSecA) . These differences likely extend to SecG interactions as well, potentially affecting translocation efficiency and substrate specificity in P. aeruginosa.

What types of proteins in P. aeruginosa require the SecG-dependent pathway for export?

The SecG-dependent pathway in P. aeruginosa is involved in the export of numerous proteins, particularly those containing N-terminal signal peptides. Computational and laboratory analyses have identified that 801 proteins (14.4% of the P. aeruginosa proteome) contain cleavable type I signal peptides that direct them to the Sec pathway . These include:

  • Virulence factors essential for pathogenesis

  • Membrane proteins needed for cellular functions

  • Periplasmic enzymes involved in cell wall synthesis and modification

  • Components of secretion systems that further export proteins to the extracellular environment

  • Proteins involved in biofilm formation and antibiotic resistance

Many of these exported proteins contribute to P. aeruginosa's pathogenicity in clinical settings, particularly in chronic respiratory infections found in up to 80% of adult cystic fibrosis patients . The export of these virulence factors through the Sec pathway makes SecG an important component in bacterial pathogenesis.

What are the most effective methods for cloning and expressing recombinant P. aeruginosa SecG?

For efficient cloning and expression of recombinant P. aeruginosa SecG, researchers should consider the following methodological approach:

  • Gene amplification and vector selection: The secG gene should be amplified from P. aeruginosa PAO1 genomic DNA using high-fidelity polymerase. For membrane proteins like SecG, expression vectors with tunable promoters (such as pET or pBAD systems) are recommended to avoid toxicity from overexpression.

  • Expression system: Similar to the approach used for SecA , expression in E. coli BL21 derivatives is recommended, but with careful consideration of growth conditions. For membrane proteins like SecG, lower induction temperatures (16-20°C) often improve proper folding and membrane insertion.

  • Purification strategy: Membrane proteins require detergent solubilization. After cell lysis, membrane fractions should be isolated by ultracentrifugation, followed by solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin. Purification can be facilitated by adding affinity tags (His6 or Strep) to either the N or C terminus, with careful evaluation to ensure tag placement doesn't interfere with function.

  • Quality assessment: Size exclusion chromatography should be used to verify protein homogeneity and oligomeric state, similar to the assessment of SecA which showed different oligomerization properties between P. aeruginosa and E. coli proteins .

The purified SecG protein should achieve >95% purity, as assessed by SDS-PAGE, with yields sufficient for downstream structural and functional studies.

How can researchers effectively engineer the P. aeruginosa genome to study SecG function in vivo?

For genomic engineering to study SecG function in P. aeruginosa, the two-step allelic exchange method is highly recommended due to its precision and versatility. This approach allows creation of scarless mutations, deletions, or tagged versions of secG without introducing heterologous recombinases . The process involves:

  • Design of mutant alleles: Create modified secG alleles with desired mutations flanked by ~500-1000 bp homology regions. For functional studies, consider point mutations in conserved residues, domain deletions, or addition of fluorescent tags for localization studies.

  • Vector construction: Clone the engineered alleles into suicide vectors like pEX18Ap or pEX19Gm that contain:

    • An antibiotic resistance marker (typically gentamicin or carbenicillin)

    • A counter-selectable marker (sacB)

    • Origin of transfer (oriT) for conjugation-based delivery

  • Two-step allelic exchange:

    • First, introduce the vector into P. aeruginosa by conjugation from E. coli, selecting for antibiotic-resistant single-crossover integrants

    • Then, counter-select on sucrose media to isolate double-crossover mutants that have lost the vector backbone

  • Verification: Confirm the desired genetic modification by PCR and sequencing. For SecG functional studies, verification should also include Western blotting to confirm protein expression levels and membrane localization analysis.

This method has been successfully deployed in multiple laboratories with a success rate of approximately 50% in clinical isolates , making it suitable for studying SecG across different P. aeruginosa strains to understand strain-specific variations in protein export mechanisms.

What assays can be used to measure SecG-dependent protein translocation efficiency in P. aeruginosa?

Several complementary assays can be employed to quantitatively measure SecG-dependent protein translocation in P. aeruginosa:

  • In vivo alkaline phosphatase (PhoA) fusion assay: This approach uses fusions of suspected SecG-dependent signal peptides with truncated PhoA lacking its own signal peptide. When successfully exported to the periplasm, PhoA becomes active and can be measured using chromogenic substrates . This method has been successfully used in genome-wide screens for exported proteins in P. aeruginosa.

  • Subcellular fractionation and immunoblotting: Separate periplasmic, cytoplasmic, and membrane fractions through differential centrifugation and osmotic shock techniques. Quantify the distribution of specific proteins known to be Sec-dependent using antibodies against native proteins or epitope tags.

  • In vitro translocation assays: Reconstitute the Sec machinery using purified components (SecA, SecYEG) and prepare proteoliposomes. Measure ATP-dependent translocation of radiolabeled or fluorescently labeled substrate proteins, comparing systems with and without SecG to determine its contribution to efficiency. The intrinsic and liposome-stimulated ATPase activities of the Sec system components can serve as readouts .

  • Pulse-chase analysis: Metabolically label proteins briefly with radioactive amino acids, then follow their localization over time to measure export kinetics in wild-type versus secG mutant strains.

When designing these experiments, researchers should be aware that SecG enhances translocation efficiency but is not absolutely required for viability in all conditions. Therefore, phenotypic effects of secG mutations may be subtle or condition-dependent, requiring careful experimental design and appropriate controls.

How does P. aeruginosa SecG function differ in antibiotic-resistant clinical isolates compared to laboratory strains?

The function of SecG in antibiotic-resistant clinical isolates of P. aeruginosa exhibits important differences compared to laboratory strains, reflecting adaptations to selective pressures in clinical environments:

  • Expression level variations: Clinical isolates, particularly those from chronic cystic fibrosis infections, often show altered expression of protein export machinery including SecG. These changes may correlate with increased export of virulence factors or antibiotic resistance determinants.

  • Genetic polymorphisms: Strain-specific genetic variations have been documented across the P. aeruginosa genome, with different phylogenetic groups showing distinct polymorphisms . These genetic differences extend to the secG gene and may affect the efficiency of protein translocation, particularly under stress conditions such as antibiotic exposure.

  • Interaction with antibiotic resistance mechanisms: In multidrug-resistant strains, where resistance has doubled over the past 30 years , the Sec pathway plays a critical role in exporting proteins involved in intrinsic resistance, such as efflux pump components. SecG function may be adapted in these strains to prioritize the export of resistance determinants.

  • Biofilm formation effects: Clinical isolates often exhibit enhanced biofilm formation, which requires efficient export of extracellular matrix components. SecG function may be optimized in these strains to support the biofilm lifestyle, which is a significant contributor to antibiotic resistance.

Researchers investigating these differences should consider using the allelic exchange methods that have been successfully applied to a library of environmental and clinical isolates with approximately 50% success rate . This approach allows direct comparison of SecG function across strain backgrounds by introducing identical mutations or tagged versions into diverse isolates.

What is the relationship between SecG and the development of antimicrobial resistance in P. aeruginosa?

The relationship between SecG and antimicrobial resistance in P. aeruginosa is complex and multi-faceted:

  • Efflux pump assembly: SecG facilitates the export and proper insertion of components of multidrug efflux pumps (such as MexAB-OprM) into the bacterial membrane. These efflux systems are major contributors to intrinsic and acquired resistance against multiple antibiotic classes in P. aeruginosa.

  • Stress response coordination: Under antibiotic pressure, P. aeruginosa upregulates various stress response pathways that depend on protein export. SecG-dependent translocation ensures proper localization of stress response proteins, potentially enhancing survival during antibiotic treatment.

  • Biofilm formation: The SecG-dependent pathway exports numerous proteins involved in biofilm formation. In P. aeruginosa infections, especially in cystic fibrosis patients where chronic infections are found in up to 80% of adults , biofilms contribute significantly to antibiotic tolerance and treatment failure.

  • Adaptation to treatment environments: In clinical settings where multidrug resistance to P. aeruginosa has doubled over the past 30 years , the efficiency of the Sec pathway may become a selective advantage. Strains with optimized protein export systems might better adapt to antibiotic pressure through more efficient export of resistance determinants.

To study this relationship experimentally, researchers should consider:

  • Creating conditional secG mutants to observe immediate effects on antimicrobial susceptibility without compensatory adaptations

  • Measuring the export efficiency of specific resistance determinants in secG mutants versus wild-type under antibiotic stress

  • Examining the correlation between SecG expression levels and minimum inhibitory concentrations across clinical isolates with varying resistance profiles

How does genome-wide recombination in P. aeruginosa affect the evolution of SecG and the Sec pathway?

Genome-wide recombination in P. aeruginosa significantly influences the evolution of SecG and the broader Sec pathway through several mechanisms:

  • Genetic diversity generation: Homologous and non-homologous recombination creates genetic diversity among P. aeruginosa strains . This diversity extends to the secG gene and other components of the Sec pathway, potentially leading to functional variations in protein export efficiency that impact fitness in different environments.

  • Horizontal gene transfer effects: P. aeruginosa strains frequently exchange genetic material, including segments containing or affecting secG. This may lead to the spread of advantageous secG alleles among different lineages, particularly in clinical settings where selective pressures favor efficient protein export.

  • Adaptation to specific niches: Different P. aeruginosa strains exhibit adaptations to specific environmental niches. Epidemic strains that spread in cystic fibrosis patients may carry secG variants that optimize the export of virulence factors relevant to respiratory infections. These strain-specific differences correlate with variation in clinical outcomes, suggesting that protein export efficiency may be a virulence determinant.

  • Co-evolution with substrate proteins: As P. aeruginosa acquires new genes through horizontal transfer, the Sec pathway must adapt to efficiently export these new proteins. This creates selective pressure for the co-evolution of SecG and other Sec components to maintain export efficiency across an evolving proteome.

Research approaches to study this evolutionary dynamics should include:

  • Comparative genomic analysis of secG sequences across phylogenetically diverse P. aeruginosa strains

  • Experimental evolution studies under selective pressures that depend on protein export

  • Functional characterization of SecG variants from different strain backgrounds in standardized genetic contexts

What computational tools can predict SecG-dependent substrates in the P. aeruginosa proteome?

Researchers studying SecG-dependent protein export in P. aeruginosa can employ several computational approaches to predict substrates:

  • Signal peptide prediction tools: A consensus approach using multiple prediction algorithms provides the most reliable results. In previous studies of P. aeruginosa, 801 proteins (14.4%) were predicted by at least three of four methods to contain a cleavable type I signal peptide . The recommended tools include:

    • SignalP (versions 5.0 or newer)

    • PrediSi

    • Signal-BLAST

    • Phobius (particularly useful for distinguishing between signal peptides and transmembrane domains)

  • Transmembrane topology prediction: For identifying membrane proteins that may require SecG for proper insertion:

    • TMHMM

    • HMMTOP

    • TOPCONS

  • Proteome-wide functional annotation:

    • InterProScan for identifying domains often associated with exported proteins

    • Gene Ontology enrichment analysis to identify functional categories overrepresented among predicted SecG substrates

  • Comparative genomic approaches:

    • Ortholog identification across bacterial species to find conserved exported proteins

    • Analysis of genomic context and operon structure to identify functionally related exported proteins

When applying these tools to P. aeruginosa, researchers should calibrate predictions using the experimentally verified dataset of exported proteins. In the previous comprehensive analysis, 518 out of 801 signal peptides had four identically predicted cleavage sites and an additional 56 signal peptides had three identically predicted cleavage sites , demonstrating the value of a consensus approach.

How can contradictory results in SecG functional studies be reconciled across different experimental systems?

Reconciling contradictory results in SecG functional studies requires systematic analysis of experimental variables that may contribute to discrepancies:

  • Strain background effects: P. aeruginosa strains exhibit significant genetic diversity, with epidemic strains showing distinct phenotypes compared to laboratory strains . Researchers should:

    • Clearly document the exact strain background used (e.g., PAO1 versus PA14)

    • Consider creating isogenic mutants in multiple strain backgrounds to determine if phenotypic differences are strain-dependent

    • Evaluate genomic differences in the sec pathway between strains used in different studies

  • Experimental condition variations:

    • Growth conditions significantly affect protein export requirements

    • Temperature, media composition, and growth phase should be standardized

    • Stress conditions (antibiotics, oxidative stress) may reveal SecG phenotypes not apparent under optimal conditions

  • Protein substrate specificity:

    • Different studies may examine different SecG-dependent substrate proteins

    • Some proteins have absolute requirements for SecG while others show only efficiency defects in its absence

    • Create a standardized panel of reporter substrates with varying dependencies on SecG

  • Methodological differences in assessing export:

    • In vivo versus in vitro approaches often yield different results

    • Quantitative differences in export efficiency may be interpreted differently across studies

    • Establish clear thresholds for what constitutes a significant defect in export

When designing experiments to resolve contradictions, researchers should implement controls that directly compare their experimental system with previously reported conditions. For instance, if purifying SecG using methods similar to those used for SecA , researchers should include appropriate controls to ensure that differences in behavior are not due to purification artifacts.

What is the relationship between SecG function and P. aeruginosa virulence in different infection models?

The relationship between SecG function and P. aeruginosa virulence varies across infection models, reflecting the diverse pathogenic mechanisms employed in different host environments:

  • Respiratory infection models:

    • In models mimicking cystic fibrosis lung infections, where P. aeruginosa causes chronic infections in up to 80% of adult patients , SecG likely plays a critical role in exporting virulence factors that establish and maintain persistent infection

    • SecG-dependent export of biofilm components is particularly important in these models

    • Strain-specific variations in SecG efficiency may contribute to the observation that epidemic strains confer poorer prognosis than non-epidemic strains

  • Acute infection models:

    • In acute pneumonia models, SecG-dependent export of toxins and proteases contributes to tissue damage

    • Type II secretion system substrates, which depend on initial Sec-mediated export, are major virulence factors in acute infections

  • Wound and burn infection models:

    • Extracellular enzymes exported via the SecG-dependent pathway contribute to tissue invasion

    • Adaptation of the Sec pathway to the wound environment may influence persistence

  • Immunocompromised host models:

    • In immunocompromised hosts, where P. aeruginosa is an efficient opportunistic pathogen , the export of immune evasion factors through the Sec pathway may be particularly important

    • The relative importance of different virulence factors (and thus their export) varies with the nature of immune compromise

Research examining these relationships should:

  • Create conditional secG mutants to examine temporal requirements during infection progression

  • Use tissue-specific reporter systems to monitor SecG-dependent protein export in vivo

  • Compare secG mutant phenotypes across diverse clinical isolates, particularly those from different infection sites

  • Correlate SecG function with clinical outcomes in patient isolates

What potential does SecG have as an antimicrobial target for P. aeruginosa infections?

SecG represents a promising but challenging antimicrobial target for P. aeruginosa infections for several reasons:

  • Essential pathway involvement: While SecG itself is not absolutely essential for viability under all conditions, it significantly enhances the efficiency of the Sec pathway, which is critical for bacterial survival. Targeting SecG could create a "bottleneck" in protein export, particularly under stress conditions relevant to infection environments.

  • Structural considerations for drug design:

    • SecG's membrane-embedded nature provides both challenges and opportunities for drug development

    • Small molecules that interfere with SecG's topology inversion during translocation could specifically inhibit its function

    • Structure-based drug design would benefit from high-resolution structural data of P. aeruginosa SecG in different conformational states

  • Potential for combination therapy:

    • SecG inhibitors might synergize with existing antibiotics by preventing the export of resistance determinants

    • This approach could be particularly valuable against multidrug-resistant P. aeruginosa, where resistance has doubled over the past 30 years

    • Combination with immune therapies, such as the IC43 recombinant P. aeruginosa vaccine , could provide multi-modal attack

  • Specificity considerations:

    • While SecG is conserved across bacteria, there are species-specific differences that could potentially be exploited for selective targeting

    • Differences between bacterial and human protein export systems provide a theoretical basis for selective toxicity

Researchers pursuing SecG as an antimicrobial target should consider:

  • High-throughput screening approaches to identify molecules that specifically interact with P. aeruginosa SecG

  • Phenotypic screens for compounds that create synthetic lethality in combination with secG mutations

  • Validation in diverse clinical isolates to ensure efficacy across the genetic diversity of P. aeruginosa

How can genome engineering techniques be optimized for studying SecG interactions with other Sec pathway components?

Optimizing genome engineering techniques for studying SecG interactions requires tailored approaches that preserve the native context while enabling precise manipulation:

These approaches should be designed with awareness of potential technical challenges in P. aeruginosa genome engineering, including strain-dependent recombination efficiencies that can vary considerably . Researchers should validate their engineering approach in their specific strain background before proceeding to large-scale studies.

What role might SecG play in adaptation of P. aeruginosa to diverse infection environments?

SecG likely plays a significant role in P. aeruginosa adaptation to diverse infection environments through several mechanisms:

  • Environment-specific protein export requirements:

    • Different infection sites (respiratory tract, wounds, urinary tract) present unique challenges requiring specific exported virulence factors

    • SecG efficiency may become particularly important when rapid adaptation to new environments is required

    • The observation that P. aeruginosa strains from different infection sources show genetic diversity suggests that protein export pathways may be optimized for specific niches

  • Host immune response evasion:

    • Export of immune evasion factors depends on the Sec pathway

    • Adaptation to specific immune pressures may involve modifications to SecG function

    • In chronic infections, such as those in cystic fibrosis patients where P. aeruginosa causes infections in up to 80% of adult patients , long-term evolution may select for optimized SecG function

  • Antibiotic resistance development:

    • The rising multidrug resistance in P. aeruginosa over the past 30 years may partially depend on efficient export of resistance determinants

    • SecG's role in membrane protein insertion could be crucial for assembling efflux pumps

    • Strain-specific variations in SecG might contribute to differences in resistance development rates

  • Biofilm formation and persistence:

    • SecG-dependent export of extracellular matrix components supports biofilm formation

    • Adaptation to chronic infection environments often involves transition to a biofilm lifestyle

    • Efficient protein export through the SecG-dependent pathway may facilitate this transition

Future research should examine:

  • Comparative genomics of secG across isolates from different infection sites

  • Experimental evolution of P. aeruginosa in model infection environments, followed by sequencing to identify adaptations in secG and related genes

  • Transcriptional and post-translational regulation of SecG in response to host environment cues

  • Correlation between SecG variants and clinical outcomes in patient isolates

By understanding SecG's role in adaptation to diverse environments, researchers may identify new approaches to prevent P. aeruginosa adaptation during infection, potentially leading to more effective treatment strategies for this opportunistic pathogen that remains a major cause of morbidity and mortality in hospitalized patients .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.