Recombinant Pseudomonas aeruginosa Protein tolQ (tolQ)

Shipped with Ice Packs
In Stock
Cat. No.
BT2463808
Source
in vitro E.coli expression system
Synonyms
tolQ; PA0969; Tol-Pal system protein TolQ
Quick Inquiry

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
tolQ; PA0969; Tol-Pal system protein TolQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
tolQ
Target Protein Sequence
MEPNVVDHTSMWSLISNASIVVQLVMLTLVAASVTSWIMIFQRGNAMRAAKKALDAFEER FWSGIDLSKLYRQAGSNPDPDSGVEQIFRAGFKEFSRLRQQPGVDPDAVMEGVARAMRVA ISREEEKLEASLPFLATVGSTSPYVGLFGTVWGIMNSFRGLATVQQATLATVAPGIAEAL IATAIGLFAAIPAVIAYNRFSARSEMLIGRYYTFADEFQAILHRKVHTSDD
Uniprot No.
P50598

Target Background

Function
A component of the Tol-Pal system, crucial for outer membrane invagination during cell division and maintaining outer membrane integrity.
Database Links

KEGG: pae:PA0969

STRING: 208964.PA0969

Protein Families
ExbB/TolQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Research Applications and Future Directions

  • How might P. aeruginosa TolQ be utilized in vaccine development research?

    While TolQ itself has not been directly used in vaccine development, research on outer membrane vesicle (OMV) vaccines has involved the Tol-Pal system. Methodological considerations for such research include:

    • Construction of recombinant strains: Generate strains with reduced virulence factors but maintained immunogenicity

    • Antigen fusion strategies: Design fusion proteins that can be incorporated into OMVs

    • Toxicity assessment: Compare toxicity of OMVs from wild-type and modified strains

    • Immunization protocols: Develop and optimize vaccination schedules

    • Protection analysis: Evaluate protection against challenge with wild-type bacteria

    • Cross-protection assessment: Test efficacy against different P. aeruginosa strains

    • Immune response characterization: Analyze both humoral and T-cell responses

    The essentiality of tolQ in P. aeruginosa suggests it may be an important target for antimicrobial development rather than direct vaccine use.

  • What techniques can be applied to study bacterial mycophagy and the potential involvement of TolQ?

    For investigating bacterial-fungal interactions and potential TolQ involvement, researchers can use:

    • Confrontation assays: Setup bacterial-fungal interaction experiments on agar plates

    • Transcriptomic approaches: Use microarray analysis to profile gene expression in both partners during interaction

    • Membrane separation techniques: Employ polycarbonate membranes to physically separate bacteria and fungi while allowing exchange of diffusible molecules

    • Genetic manipulation: Create knockout or complementation strains to evaluate the role of specific genes like tolQ

    • Chemical analysis: Identify and characterize secondary metabolites produced during the interaction

    • Comparative genomics: Analyze distribution of tolQ and related genes across different bacterial species

    These approaches provide comprehensive tools for investigating complex microbial interactions and determining if TolQ plays a role in these processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.