Recombinant Pseudomonas aeruginosa Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Overview of the Sec System in Pseudomonas aeruginosa

The Sec pathway is a conserved protein secretion system responsible for translocating unfolded proteins across the inner membrane. In P. aeruginosa, this system is critical for exporting virulence factors, enzymes, and other proteins essential for pathogenesis or environmental adaptation. Key components include:

  • SecA: ATPase that binds precursor proteins and drives translocation.

  • SecYEG: Core translocon forming a channel across the inner membrane.

Function:

  • Translocates Sec-dependent substrates (e.g., phospholipase C, elastase) to the periplasm.

  • Acts as a general export pathway for periplasmic and outer membrane proteins.

Example:
The Sec system translocates the N-terminal signal peptide of phospholipase PlcH, which is later secreted via the Tat pathway .

Sec System Interactions with Other Secretion Pathways

The Sec system collaborates with other secretion pathways (e.g., Tat, T2SS) to achieve extracellular protein release.

Example Pathways:

  1. Tat-Sec Hybrid Secretion:

    • PlcH (a phospholipase) uses the Tat system for inner membrane translocation but relies on the T2SS (e.g., Xcp) for outer membrane secretion .

  2. T2SS Substrate Export:

    • Proteins like elastase and exotoxin A are translocated via the Sec system to the periplasm before being secreted by the Xcp or Hxc T2SS .

Challenges and Gaps in SecD Research

While the Sec system is well-characterized in P. aeruginosa, SecD (a component often associated with the Sec translocon in other bacteria) is not mentioned in the provided literature. This absence suggests:

  • Potential Redundancy or Absence: SecD may not be essential in P. aeruginosa or may have divergent roles.

  • Focus on Core Components: Research has prioritized SecA, SecY, and SecE/G over SecD in this organism.

Comparative Analysis of Sec System Components

Below is a table comparing Sec components in P. aeruginosa with their E. coli homologs, based on available data.

ComponentFunction in P. aeruginosaFunction in E. coliKey Differences
SecAATPase for translocation ATPase for translocationSubstrate specificity may vary.
SecYEGTranslocon pore Translocon poreStructural conservation .
SecD/FNot reportedAuxiliary translocon subunitsAbsent in P. aeruginosa literature.

Implications for Recombinant Protein Production

The Sec system’s role in protein secretion has implications for biotechnological applications:

  • Recombinant Expression: P. aeruginosa’s Sec system is leveraged for secreting heterologous proteins (e.g., human gp100) fused to T3SS substrates, avoiding inclusion body formation .

  • Antibiotic Resistance: Sec-dependent efflux pumps (e.g., MexAB-OprM) are critical for multidrug resistance, as shown by experiments replacing Sec-dependent signal peptides with Tat-derived sequences .

References

  1. Sec-Tat Hybridization:

  2. Tat-Sec Collaboration:

  3. SecA/SecY Mutants:

  4. Recombinant Protein Production:

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
secD; PA3821; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-620
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
secD
Target Protein Sequence
MLNKYPLWKYLLILAVLAVGFIYSAPNLYPDDPAVQISGASTALQVTQADVDRAAKALTD AGIAVKADSLSKKGGLIRLVKQDDQLPAKEVVRRTLGDDYVVALNLAQTTPEWLRKLGGS PMKLGLDLSGGVHFLLEVDMDKAVDARLKVYESEVKSLLRKERVRYRSLPIQDRAIQLGF TDSESLDKARSLIAKDFRDFEVVPEERNGLQVLRVALTQAKLAEIREYSIKQNLTTVRNR VNELGVSEPLVQRQGANRIVVELPGVQDTAEAKRILGKTANLEFRLAAEPDALKSATETF EFREPRRPPVPLERGVIITGDQVTDASASFDENGRPQVNIRLDGHGGELMNRATRNNVGR SMAVVFIEQKPVTRYTKQMVDGVEKEVAVPAFKEEKQIISLATIQSPLGNQFRITGLDGP GESSELALLLRAGGLAAPMYFAEERTIGPSLGADNIAKGIDASLWGMLFVSLFIIVIYRF FGVIATVALAFNMVMLVALMSILGATLTLPGIAGIVLTMGMAVDANVLIFSRIREELANG MSVQRAIHEGFNRAFTAILDANLTSLLVGGILYAMGTGPVKGFAVTMSLGIITSMFTAIM VTRAMVNLIFGGRDFKKLWI
Uniprot No.

Target Background

Function
SecD is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links

KEGG: pae:PA3821

STRING: 208964.PA3821

Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of SecD in the Sec protein translocation system of Pseudomonas aeruginosa?

SecD is a critical component of the Sec protein secretion machinery in P. aeruginosa, functioning as an accessory subunit that enhances the efficiency of protein translocation across the inner membrane. The Sec pathway is one of the primary protein secretion systems in P. aeruginosa, alongside the Tat pathway, and is responsible for translocating unfolded proteins across the cytoplasmic membrane . SecD works in conjunction with SecF to form a heterodimeric complex that associates with the SecYEG translocon. While SecA provides the ATP-driven motor function for protein translocation , SecD contributes to the later stages of translocation by preventing backward movement of translocating proteins and assisting in their release into the periplasm.

How does the Sec pathway contribute to P. aeruginosa virulence and pathogenicity?

The Sec system plays a crucial role in P. aeruginosa pathogenicity by facilitating the secretion of numerous virulence factors and essential membrane proteins. P. aeruginosa is an opportunistic pathogen that causes life-threatening infections in immunocompromised individuals and patients with cystic fibrosis . The Sec pathway translocates the xenobiotic transporter MexAB-OprM, which contributes to antibiotic resistance . Research has demonstrated that the Sec system is essential for P. aeruginosa survival and virulence, as it enables the bacterium to secrete "a wide range of hydrolytic enzymes, toxins, and virulence factors into the extracellular medium" . Through this secretion mechanism, the Sec pathway directly contributes to the bacterium's ability to establish infections, evade host defenses, and develop antibiotic resistance.

What is the genetic organization of the secD gene in the P. aeruginosa genome?

The secD gene in P. aeruginosa is typically found in an operon with secF, reflecting their functional relationship as components that work together in protein translocation. While the search results don't provide specific details about the genetic organization of secD, comparative genomic analyses of bacterial Sec systems indicate that secD and secF genes are frequently co-transcribed. The P. aeruginosa genome has been extensively sequenced and analyzed , with studies identifying "significant differences between epidemic and sporadic isolate genomes" in various cellular processes including transcriptional control . This genomic information provides a foundation for understanding the evolutionary conservation and importance of the secD gene across P. aeruginosa strains.

What methods are most effective for expressing and purifying recombinant P. aeruginosa SecD?

Based on successful approaches used for other P. aeruginosa Sec components, the following methodology is recommended for SecD:

Expression system:

  • Express in E. coli BL21(DE3) or similar expression strains

  • Use a vector with an inducible promoter such as T7

  • Consider expressing under conditions where native E. coli SecD is depleted to avoid contamination

Purification protocol:

  • Ammonium sulfate fractionation to facilitate binding to ion-exchange columns

  • Cation-exchange chromatography (SP-Sepharose) for initial purification

  • Size exclusion chromatography to achieve >98% purity

This approach has yielded successful results for P. aeruginosa SecA (PaSecA) with "a recovery of more than 20% from the soluble fraction" . For membrane proteins like SecD, additional considerations include:

  • Using appropriate detergents for membrane protein solubilization

  • Osmotic shock as an initial step to efficiently release the targeted protein from cells

  • Following with cation-exchange and size exclusion columns to obtain homogeneous protein

How do researchers verify the proper folding and activity of recombinant P. aeruginosa SecD?

Verification of proper folding and functional activity of recombinant P. aeruginosa SecD involves multiple complementary approaches:

Structural integrity assessment:

  • Size exclusion chromatography to determine oligomeric state

  • Circular dichroism spectroscopy to evaluate secondary structure content

  • Limited proteolysis to assess domain folding

Functional assays:

  • In vitro protein translocation assays using purified SecYEG translocon components

  • ATPase stimulation assays measuring the ability of SecD to enhance SecA ATPase activity

  • Reconstitution into liposomes to assess membrane integration and protein transport

When studying PaSecA, researchers found that "the purified PaSecA possessed ATPase activity; the intrinsic and liposome-stimulated ATPase specific activities of PaSecA were approximately 50% of EcSecA" . Similar comparative approaches could be applied to SecD, comparing its activity to that of the E. coli homolog. Additionally, complementation studies in SecD-depleted strains can provide in vivo confirmation of functional activity.

What are the challenges in creating secD mutants in P. aeruginosa and how can they be overcome?

Creating secD mutants in P. aeruginosa presents several challenges due to the essential nature of the Sec system, but various strategies can be employed:

Challenges:

  • SecD is likely essential for viability, making null mutants potentially lethal

  • P. aeruginosa is naturally resistant to many antibiotics, limiting selection markers

  • Efficiency of homologous recombination varies between P. aeruginosa strains

Recommended approaches:

  • Use conditional mutants:

    • Temperature-sensitive alleles

    • Inducible promoter systems to control expression levels

  • Apply precision genome engineering techniques:

    • Two-step allelic exchange using suicide vectors with counter-selection markers

    • "Unlike other approaches to allelic exchange, this protocol does not require heterologous recombinases to insert or excise selective markers from the target chromosome"

  • Specific methodology:

    • Clone mutant alleles into suicide vectors with appropriate antibiotic resistance and counter-selection markers (e.g., sacB)

    • Introduce vectors by conjugation from E. coli into P. aeruginosa

    • Select for single crossovers using antibiotic resistance

    • Counter-select for double crossovers using sucrose sensitivity to identify desired mutants

This approach has been "deployed into 9 Pseudomonas laboratories in 4 countries" and used to create "more than a thousand mutants of laboratory strains PAO1 and PA14" .

How can structural data of SecD be used to design specific inhibitors as potential antimicrobial agents?

Designing specific inhibitors targeting P. aeruginosa SecD requires a comprehensive structural biology and rational drug design approach:

Structural determination strategies:

  • X-ray crystallography of SecD alone or in complex with SecF/SecYEG

  • Cryo-EM analysis of the entire Sec translocon including SecD

  • NMR spectroscopy of specific domains for dynamic information

  • Molecular dynamics simulations to identify binding pockets and conformational changes

Drug design workflow:

  • Virtual screening of compound libraries against identified binding pockets

  • Structure-based optimization of hit compounds

  • Molecular dynamics simulation and MM-PBSA/GBSA calculations to assess stability and binding affinity

Target site selection criteria:

  • Conserved domains essential for function

  • Sites that differ from human homologs

  • Regions critical for protein-protein interactions

Drug Discovery PhaseMethodsExpected Outcomes
Target validationGene knockdown, complementationConfirmation of SecD essentiality
Hit identificationVirtual screening, fragment-basedInitial compounds with µM affinity
Hit-to-leadMedicinal chemistry, SAROptimized compounds with nM affinity
Lead optimizationADME, toxicity studiesDrug-like compounds with targeted activity

This rational drug design strategy, similar to approaches used for other P. aeruginosa targets like PqsA , could yield novel antimicrobial agents effective against multidrug-resistant strains.

What methodological considerations are important when studying SecD-dependent protein secretion in biofilm versus planktonic P. aeruginosa cells?

Studying SecD-dependent protein secretion in different growth conditions requires specialized approaches to account for physiological differences:

Experimental design considerations:

  • Growth condition establishment:

    • For biofilms: Use Drip Flow Biofilm Reactor with an air-liquid interface to mimic lung infections

    • For planktonic cells: Liquid culture with appropriate aeration

    • Control for growth phase differences (log vs. stationary)

  • Protein secretion analysis:

    • Implement subcellular fractionation protocols optimized for each growth condition

    • Account for extracellular matrix in biofilm samples (requires additional processing)

    • Use quantitative proteomics (LC-MS/MS) with stable isotope labeling

  • SecD function assessment:

    • Construct conditional SecD mutants compatible with biofilm formation

    • Develop in situ activity assays that work within biofilm architecture

    • Use fluorescent reporter fusion proteins to visualize secretion in real-time

  • Data interpretation challenges:

    • Normalize protein secretion data to account for different cell densities

    • Consider diffusion limitations in biofilms that may affect apparent secretion efficiency

    • Validate findings using multiple strains to account for strain-specific variations

Biofilm-specific methodology table:

ParameterBiofilm MethodPlanktonic MethodKey Difference
Sample preparationMatrix digestion + mechanical disruptionSimple centrifugationMatrix interference in biofilms
Cell lysisSonication with increased intensityStandard sonicationBiofilm cells more resistant to lysis
Secretome isolationFiltration through multiple pore sizesSingle filtration stepMatrix components can clog filters
QuantificationConsider spatial heterogeneityHomogeneous samplesSampling must account for biofilm architecture

The optimization of an "in vitro air-liquid interface pharmacokinetic/pharmacodynamic biofilm model" provides valuable insights for designing experiments that accurately reflect the physiological state of P. aeruginosa in different environments.

How does the interaction between SecD and other Sec components differ in antibiotic-resistant versus susceptible P. aeruginosa strains?

Understanding the variations in Sec system functionality between antibiotic-resistant and susceptible strains requires sophisticated comparative approaches:

Research methodology:

  • Strain selection criteria:

    • Include representatives of the "21 major clones" or "epidemic clones" identified in global P. aeruginosa populations

    • Compare clinical isolates with varying antibiotic resistance profiles

    • Include laboratory reference strains (PAO1, PA14) as controls

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation of SecD with other Sec components

    • Bacterial two-hybrid assays to quantify interaction strengths

    • Fluorescence resonance energy transfer (FRET) for in vivo interaction dynamics

  • Functional comparison methods:

    • Measure translocation efficiency of model Sec substrates

    • Compare assembly rates of outer membrane proteins dependent on Sec pathway

    • Assess impact of antibiotic challenge on Sec system function

  • Genetic basis of differences:

    • Sequence analysis of sec genes across strain collection

    • Expression level comparison using RT-qPCR

    • Transcriptome analysis to identify regulatory differences

Comparative data from resistant vs. susceptible strains:

Research has shown that antibiotic resistance in P. aeruginosa often involves changes in membrane permeability and efflux pump expression . For example, "MexA-deficient cells harboring the plasmid carrying the plcH-mexA fusion gene showed antibiotic resistance comparable to that of the wild-type cells" , demonstrating the importance of properly functioning secretion systems for antibiotic resistance phenotypes. The Sec system's role in translocating components of efflux pumps like MexAB-OprM suggests that alterations in SecD function or expression could potentially contribute to resistance mechanisms.

What approaches can be used to resolve contradictory data regarding SecD function in different experimental systems?

When faced with contradictory findings about SecD function, researchers should implement a structured approach to identify sources of discrepancy:

Systematic troubleshooting framework:

  • Standardize experimental conditions:

    • Develop a consensus protocol with defined media, growth conditions, and strain backgrounds

    • Create a reference strain collection accessible to all researchers

    • Implement interlaboratory validation studies with identical materials

  • Apply multiple complementary techniques:

    • Combine genetic, biochemical, and structural approaches

    • Use both in vivo and in vitro assays to cross-validate findings

    • Apply single case experimental design (SCED) principles for detailed analysis

  • Control for strain-specific variations:

    • Test hypotheses across multiple clinical and laboratory strains

    • Sequence verify strains used in different laboratories

    • Consider the impact of "host-specific adaptation" known to occur in P. aeruginosa

  • Statistical and methodological considerations:

    • Apply visual analysis techniques from SCED studies to identify data patterns

    • Ensure reliability data for dependent measures

    • Verify fidelity of implementation of study procedures

  • Data integration approaches:

    • Meta-analysis of published studies following SCED research synthesis methods

    • Develop mathematical models to reconcile apparently contradictory data

    • Consider environmental context that might explain different outcomes

Decision matrix for resolving contradictory findings:

Contradiction TypePossible CausesResolution Approach
Different phenotypes from secD mutationsStrain background effectsIntroduce identical mutations in isogenic strains
Varying protein interaction resultsDifferences in experimental conditionsStandardize protein purification and interaction assays
Inconsistent localization dataTag interference with functionTest multiple tagging strategies and validate functionality
Conflicting essentiality findingsConditional requirementsTest under diverse growth conditions and stresses

By implementing this structured approach and recognizing that "strain-specific differences correlate with variation in clinical outcomes" , researchers can better understand genuine biological variation versus experimental artifacts.

How can advanced imaging techniques be optimized to visualize SecD-mediated protein translocation in live P. aeruginosa cells?

Visualizing SecD-mediated protein translocation in live bacteria requires state-of-the-art imaging approaches adapted specifically for P. aeruginosa:

Advanced imaging methodology:

  • Fluorescent protein fusion design:

    • Create functional SecD-fluorescent protein fusions (validated by complementation)

    • Develop orthogonal labeling systems using split fluorescent proteins

    • Design Sec-dependent cargo proteins with distinct fluorescent tags

  • Super-resolution microscopy optimization:

    • Single-molecule localization microscopy (PALM/STORM) for nanoscale resolution

    • Stimulated emission depletion (STED) microscopy for live-cell dynamics

    • Lattice light-sheet microscopy for rapid 3D imaging with reduced photodamage

  • Imaging parameters for P. aeruginosa:

    • Account for the small cell size (~0.5-1.0 µm diameter)

    • Optimize mounting techniques to minimize movement

    • Implement deconvolution algorithms specific to rod-shaped bacteria

  • Correlative imaging approaches:

    • Combine fluorescence with electron microscopy for structural context

    • Integrate with single-particle tracking for diffusion analysis

    • Perform Förster resonance energy transfer (FRET) to detect protein interactions

  • Data analysis pipeline:

    • Develop automated image segmentation for P. aeruginosa cells

    • Implement tracking algorithms for dynamic translocation events

    • Perform quantitative spatial statistics for distribution patterns

Experimental design considerations:

When adapting these techniques from model organisms like E. coli to P. aeruginosa, researchers should consider the unique challenges posed by this organism, including its intrinsic antibiotic resistance mechanisms and membrane composition differences. Special attention should be paid to maintaining cell viability during imaging, as physiological conditions are critical for authentic Sec system function.

What strategies can be used to express and study SecD from multidrug-resistant clinical isolates of P. aeruginosa?

Working with SecD from multidrug-resistant clinical isolates presents unique challenges that require specialized approaches:

Isolation and characterization protocol:

  • Clinical strain handling:

    • Implement appropriate biosafety protocols for MDR strains

    • Verify antibiotic resistance profiles using standardized testing

    • Sequence secD and surrounding genomic regions to identify variations

  • Heterologous expression strategies:

    • Clone secD variants into expression vectors with strong, inducible promoters

    • Express in E. coli strains optimized for membrane protein production

    • Consider cell-free expression systems for highly toxic variants

  • Purification adaptations:

    • Modify purification protocols based on amino acid variations

    • Test multiple detergent conditions for optimal extraction

    • Implement on-column folding strategies if inclusion bodies form

  • Functional comparative analysis:

    • Develop complementation assays in laboratory strains

    • Create chimeric proteins to identify domains responsible for functional differences

    • Measure protein translocation efficiency using standardized reporter substrates

Strain-specific considerations table:

MDR Strain CharacteristicPotential Impact on SecDMethodological Adaptation
Altered membrane compositionChanged SecD stability or insertionOptimize membrane mimetics for purification
Genetic polymorphisms in secDModified function or interactionsStructure-function analysis of variants
Different expression levelsAltered stoichiometry with partnersQuantitative expression analysis across conditions
Regulatory variationsContext-dependent activityStudy SecD under relevant stress conditions

Studies have shown that P. aeruginosa "epidemic clones caused most clinical P. aeruginosa infections worldwide" and "had all spread globally" . Understanding SecD variations in these prevalent strains could provide insights into their success and potential vulnerabilities for therapeutic targeting.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.