Recombinant Pseudomonas aeruginosa Putative transporter protein AmiS (amiS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have a specific format requirement, kindly specify it during order placement. We will endeavor to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for precise delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to settle the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
amiS; PA3362; Putative transporter protein AmiS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
amiS
Target Protein Sequence
MLGLVLLYVGAVLFLNAVWLLGKISGREVAVINFLVGVLSACVAFYLIFSAAAGQGSLKA GALTLLFAFTYLWVAANQFLEVDGKGLGWFCLFVSLTACTVAIESFAGASGPFGLWNAVN WTVWALLWFCFFLLLGLSRSIQKPVAYLTLASAIFTAWLPGLLLLGQVLKA
Uniprot No.

Target Background

Function
AmiS is a potential transporter protein that may play a role in the adsorption of amidase substrates or the release of their hydrolysis products. AmiB and AmiS might work together as a two-component ABC transporter system.
Database Links

KEGG: pae:PA3362

STRING: 208964.PA3362

Protein Families
AmiS/UreI family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Recombinant Pseudomonas aeruginosa Putative transporter protein AmiS (amiS)?

AmiS is a putative transporter protein derived from Pseudomonas aeruginosa, specifically from strain ATCC 15692 (also known as PAO1, which is a reference strain with designations DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101). The protein is typically produced as a recombinant product using E. coli expression systems, achieving a purity of >85% as determined by SDS-PAGE analysis. It plays a potential role in bacterial transport mechanisms, though its precise functional characteristics continue to be investigated in current research contexts .

What are the optimal storage conditions for recombinant AmiS protein?

Recombinant AmiS protein storage stability depends on several factors including buffer composition, storage temperature, and the protein's inherent stability. For optimal results, store liquid formulations at -20°C/-80°C, where they maintain stability for approximately 6 months. Lyophilized forms demonstrate extended shelf life, remaining stable for up to 12 months when stored at -20°C/-80°C. Importantly, repeated freeze-thaw cycles should be avoided as they can compromise protein integrity. For short-term work, aliquots can be maintained at 4°C for up to one week without significant degradation .

How should recombinant AmiS protein be reconstituted for experimental use?

Prior to opening, briefly centrifuge the vial to ensure all contents are collected at the bottom. For reconstitution, use deionized sterile water to achieve a final concentration between 0.1-1.0 mg/mL. To enhance stability for long-term storage, add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) and prepare multiple small-volume aliquots before storing at -20°C/-80°C. This approach minimizes freeze-thaw cycles while maintaining protein integrity for downstream applications .

How can recombinant AmiS protein be utilized in biofilm research models?

For biofilm research applications involving P. aeruginosa, recombinant AmiS protein can be integrated into artificial sputum medium (ASM) systems that mimic the physiological conditions found in cystic fibrosis patients' airways. This approach provides a more relevant experimental context than conventional growth media. When establishing such models, researchers should consider that P. aeruginosa biofilms typically demonstrate reduced antibiotic responsiveness in ASM compared to standard laboratory media, which more accurately reflects clinical scenarios. Additionally, monitoring for the emergence of small colony variants is crucial, as these alternative growth forms can be selected for during antimicrobial therapy and contribute to pathology progression .

What methodologies are recommended for studying AmiS function in drug susceptibility contexts?

A microfluidic approach offers significant advantages for studying AmiS function in relation to antimicrobial susceptibility. Researchers can employ drug susceptibility testing microfluidic (DSTM) devices prepared using soft lithography, consisting of multiple microfluidic channels that share a common inlet slot. This configuration enables simultaneous microscopic observation across different experimental conditions. For specific protocols, bacterial suspensions in cation-adjusted Mueller-Hinton broth can be introduced to channels pre-loaded with antimicrobials and incubated for approximately 3 hours. Susceptibilities can then be evaluated by observing differences in cell morphology between drug-treated samples and controls using dedicated image analysis software .

What are the recommended approaches for managing experimental data related to AmiS research?

Implementing FAIR (Findable, Accessible, Interoperable, Reusable) principles for AmiS-related experimental data is essential for effective research management and collaboration. Rather than attempting to retrofit existing data to meet FAIR standards retrospectively, researchers should incorporate these principles into upstream data collection and management protocols. This proactive approach enhances data utility while reducing the effort required for later compliance. For complex multifactorial experiments involving AmiS function or expression analyses, developing standardized data schemas that capture experimental design parameters, analytical methods, and results in a structured format facilitates both human interpretation and machine readability of research outputs .

How should researchers structure data tables for AmiS experimental results to enhance reproducibility?

When creating data tables for AmiS experimental results, researchers should follow standardized formats that enhance both human readability and computational analysis. Tables should include comprehensive metadata sections detailing experimental conditions, instrument parameters, and analytical methods. For quantitative measurements, include units, detection limits, and statistical parameters. When recording protein characteristics, consistently document concentration, purity, batch information, and storage conditions. Additionally, implement unique identifiers for samples and experimental runs to facilitate cross-referencing across multiple datasets. This structured approach not only supports reproducibility but also enables more effective meta-analyses across different studies investigating AmiS functionality .

What techniques can be used to investigate potential interactions between AmiS and antimicrobial compounds?

Advanced investigation of AmiS-antimicrobial interactions requires a multi-methodological approach. Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can provide direct binding parameters including affinity constants and thermodynamic profiles. For structural insights, X-ray crystallography or cryo-electron microscopy of AmiS-antimicrobial complexes can reveal binding sites and conformational changes. Functional impacts can be assessed through transport assays using fluorescently labeled substrates in reconstituted membrane systems. Additionally, site-directed mutagenesis targeting potential binding residues, followed by comparative binding and functional assays, can validate computational predictions of interaction sites. Integration of these approaches provides comprehensive characterization of how antimicrobials interact with and potentially inhibit AmiS function .

How can researchers differentiate between direct effects on AmiS and secondary cellular responses in experimental systems?

Differentiating direct AmiS effects from secondary cellular responses requires carefully designed control experiments. Implement parallel studies comparing wild-type P. aeruginosa with amiS knockout or overexpression strains to isolate protein-specific effects. Complement this with in vitro systems using purified recombinant AmiS in artificial membrane environments to examine direct effects without cellular context. Time-course experiments capturing rapid responses (likely direct effects) versus delayed changes (potentially secondary adaptations) provide temporal discrimination. Additionally, conduct transcriptomic or proteomic analyses to identify compensatory pathways activated in response to AmiS modulation. For antimicrobial studies, compare effects on purified AmiS activity against whole-cell responses to distinguish target-specific interactions from broader cellular impacts .

What are the recommended approaches for investigating AmiS in the context of biofilm formation and antibiotic resistance?

To comprehensively investigate AmiS in biofilm contexts, researchers should utilize artificial sputum medium (ASM) systems that accurately reflect the rheological properties of patient sputa. This methodological choice is critical as P. aeruginosa demonstrates significantly different antibiotic responsiveness in ASM compared to conventional media. Experimental designs should incorporate both planktonic and biofilm growth conditions with standardized methods for biofilm quantification, including crystal violet staining, confocal microscopy for structural analysis, and viable cell enumeration. When evaluating antibiotic effects, monitor not only killing efficacy but also the emergence of small colony variants which represent an alternative bacterial growth mode relevant to pathology progression. Additionally, implement comparative transcriptomic analysis between planktonic and biofilm states to identify differential expression patterns of amiS and related genes under various antimicrobial pressures .

What are common pitfalls in working with recombinant AmiS and how can they be addressed?

Common challenges when working with recombinant AmiS include protein aggregation, loss of functional activity during purification, and batch-to-batch variability. To address aggregation issues, optimize buffer conditions by screening various pH ranges (typically 6.8-8.0) and include stabilizing agents such as glycerol (5-10%) or low concentrations of non-ionic detergents. For activity preservation, minimize freeze-thaw cycles by preparing single-use aliquots and consider adding protease inhibitor cocktails during purification and storage. To reduce batch variability, implement standardized expression and purification protocols with defined metrics for acceptable purity (>85% by SDS-PAGE), concentration ranges, and functional activity assays. Additionally, maintain detailed records of expression conditions, purification steps, and quality control results for each batch to facilitate troubleshooting if inconsistencies arise .

How can researchers validate the functional activity of recombinant AmiS preparations?

Functional validation of recombinant AmiS requires multiple complementary approaches. Develop a transport activity assay using fluorescently labeled putative substrates in reconstituted membrane vesicles or proteoliposomes containing purified AmiS. Monitor substrate accumulation or efflux spectroscopically under various conditions. Complement this with binding assays such as microscale thermophoresis or fluorescence anisotropy to confirm interaction with potential substrates or inhibitors. Additionally, circular dichroism spectroscopy can verify proper protein folding by comparing spectra with previously characterized preparations. For biological relevance, demonstrate functional complementation by expressing the recombinant protein in amiS-deficient P. aeruginosa strains and assessing restoration of wild-type phenotypes. Finally, implement batch-specific quality control parameters including specific activity thresholds to ensure experimental reproducibility .

What emerging technologies hold promise for advancing AmiS research?

Several cutting-edge technologies offer significant potential for advancing AmiS research. Cryo-electron microscopy now provides near-atomic resolution structures of membrane proteins in native-like environments, potentially revealing AmiS conformational states during transport cycles. Microfluidic "organ-on-a-chip" systems modeling lung epithelium could enable study of AmiS function during host-pathogen interactions under physiologically relevant conditions. CRISPR-Cas9 genome editing permits precise manipulation of amiS and related genes in P. aeruginosa, facilitating investigation of structure-function relationships. Advanced imaging techniques, including super-resolution microscopy and correlative light-electron microscopy, allow visualization of AmiS localization and dynamics within bacterial cells and biofilms. Integration of these technologies with systems biology approaches and machine learning algorithms can accelerate identification of novel inhibitors and clarify AmiS's role in virulence and antibiotic resistance mechanisms .

How might research on AmiS contribute to novel antimicrobial development strategies?

AmiS research holds significant potential for innovative antimicrobial development through multiple pathways. If validated as an essential transporter, AmiS could serve as a direct drug target, with structure-based drug design approaches leveraging crystallographic or cryo-EM determined structures to develop specific inhibitors. High-throughput screening of compound libraries against purified AmiS could identify lead molecules that disrupt transport function. Additionally, understanding AmiS's role in biofilm formation could inform anti-biofilm strategies that enhance conventional antibiotic efficacy. For applied therapeutic development, microfluidic platforms offer rapid assessment of candidate molecules against clinical isolates, accelerating the translation from laboratory findings to clinical applications. This multi-faceted approach could contribute to addressing the critical need for novel antimicrobials against P. aeruginosa, particularly for cystic fibrosis patients where conventional treatment options are increasingly limited by resistance mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.