Recombinant Pseudomonas aeruginosa Putative zinc metalloprotease PA3649 (PA3649)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
PA3649; Putative zinc metalloprotease PA3649
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
PA3649
Target Protein Sequence
MSALYMIVGTLVALGVLVTFHEFGHFWVARRCGVKVLRFSVGFGTPLVRWHDRHGTEFVV AAIPLGGYVKMLDEREAEVPAHLLEQSFNRKTVRQRIAIVAAGPIANFLLAILFFWVVAL LGSQQVRPVIGSVAPESLAAQAGLEAGQELLAVDGEPVTGWNGVNLQLVRRLGESGTLEV RVQEKGSNVDSTHQVRLDGWLKGEDNPDPIASLGIRPWRPALPPVLAELDPKGPAQAAGL KLGDRLQSIDGIAVDDWQQVVDSVRARPGQRVQLKVLRDGEVLDVALELAVRGEGKARSG YMGAGVAGTEWPAEMLREVSYGPLEAVGQALSRTWTMSLLTLDSIKKMLLGELSVKNLSG PITIAKVAGASAQSGVGDFLNFLAYLSISLGVLNLLPIPVLDGGHLLFYLVEWVRGRPLS ERVQAWGMQIGISLVVGVMLLALVNDLSRL
Uniprot No.

Target Background

Database Links

KEGG: pae:PA3649

STRING: 208964.PA3649

Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of PA3649 (MucP) in Pseudomonas aeruginosa?

PA3649 (MucP) is a 1,353-bp open reading frame encoding a 450-amino acid protein with a molecular weight of 48 kDa. It shows 63% identity to the Escherichia coli inner membrane metalloprotease RseP/YaeL . Structural analysis reveals four transmembrane helices and one membrane-associated β-loop domain. The protein contains a conserved HEXXH metalloprotease zinc-binding motif at positions 21-25, which is essential for its proteolytic activity . Additionally, it possesses two PDZ binding domains between amino acids 111-190 and 211-287, involved in protein-protein interactions and C-terminus processing, and an RIP motif located between amino acids 401-403 .

Functionally, MucP operates as a key regulator in the alginate production pathway of P. aeruginosa, particularly in mucoid strains relevant to cystic fibrosis infections. It participates in regulated intramembrane proteolysis, a mechanism that controls the activity of the AlgT/U sigma factor responsible for alginate synthesis .

How does PA3649 (MucP) contribute to the mucoid phenotype in Pseudomonas aeruginosa?

PA3649 (MucP) plays a crucial role in the conversion between mucoid and non-mucoid phenotypes in P. aeruginosa. In wild-type strains, MucP works together with AlgO in a regulated intramembrane proteolysis pathway that controls the release of the AlgT/U sigma factor . When P. aeruginosa transitions to a mucoid phenotype, particularly in cystic fibrosis patients' lungs, it begins constitutive synthesis of the exopolysaccharide alginate, which is controlled by the AlgT/U sigma factor .

Interestingly, mutations in mucP can restore the non-mucoid phenotype in mucoid strains like PDO300 (which contains the mucA22 allele), demonstrating its essential role in maintaining the mucoid state . Complementation studies show that introducing functional mucP on a plasmid can restore the mucoid phenotype in mucP mutants, with alginate levels measurable by carbazole assay .

What crystallographic data is available for PA3649 (MucP)?

The crystal structure of the MucP PDZ1 domain from Pseudomonas aeruginosa PAO1 has been determined by X-ray diffraction at a high resolution of 1.06 Å . This structure (PDB ID: 7XFS) was deposited on April 2, 2022, and provides detailed atomic-level information about this functional domain of the protein . The structural data confirms that PA3649 is a putative zinc metalloprotease and offers insights into how its PDZ domain might participate in protein-protein interactions essential for its regulatory functions . The high resolution of this structure (1.06 Å) allows researchers to visualize fine structural details, including the precise positioning of atoms within the PDZ domain, which is critical for understanding substrate recognition and binding mechanisms.

How do the AlgO/MucP and MucE/AlgW pathways interact to regulate alginate production?

Mechanistically, these pathways likely control the sequential proteolysis of the anti-sigma factor MucA, which normally sequesters the AlgT/U sigma factor. When MucA is degraded through these proteolytic cascades, AlgT/U is released and can activate the transcription of alginate biosynthesis genes . The balance between these pathways appears critical, as experimental data shows that optimized levels of MucP are required for maximum alginate production, while overexpression can paradoxically decrease alginate levels .

What methodological approaches are effective for studying PA3649 (MucP) activity in different Pseudomonas aeruginosa strains?

For investigating PA3649 (MucP) functionality across different P. aeruginosa strains, a multi-faceted approach is recommended:

  • Genetic complementation: Using a minimal tiling path cosmid library for complementation analysis has proven effective for mapping mutations in mucP. This approach successfully identified mucP as a complementing gene for spontaneous non-mucoid variants derived from mucoid strains .

  • Controlled expression systems: Employing IPTG-inducible promoters (such as P trc) allows for titrated expression of mucP to study dose-dependent effects. Research shows that MucP levels must be precisely controlled, as even low expression from leaky promoters can affect alginate production, while overexpression decreases alginate synthesis .

  • Cross-strain validation: Testing MucP effects in laboratory strains (PAO1, PDO300) and clinical isolates (PA2192) provides comprehensive insights into strain-dependent functionality. The observation that mucP overexpression suppresses alginate production in mucoid clinical isolates but has no effect on non-mucoid PAO1 highlights the importance of genetic background in MucP function .

  • Quantitative alginate assays: The carbazole assay provides reliable quantification of alginate production, allowing precise measurement of how MucP manipulation affects the mucoid phenotype. This method detected significant differences in alginate levels between strains and under different expression conditions .

How does PA3649 (MucP) expression change under spaceflight conditions, and what implications does this have for biofilm formation?

Research investigating P. aeruginosa biofilm formation under microgravity conditions has identified changes in gene expression patterns that may involve PA3649 . While detailed expression data specifically for PA3649 is limited in the available literature, the pathways enrichment analysis in spaceflight studies indicates potential regulatory shifts in proteolytic processes that could involve membrane proteases like MucP .

In microgravity, P. aeruginosa exhibits altered biofilm morphology and increased planktonic growth compared to Earth gravity controls. For instance, cultures grown for three days in microgravity showed 41.3% higher optical density for stainless steel substrates and 23.4% higher for lubricant-impregnated surfaces . These changes correlate with modifications in gene expression profiles, particularly in genes involved in extracellular matrix production like pslO, which showed a 3.1-fold increase at day three .

The potential involvement of PA3649 in these adaptations merits further investigation, particularly given its role in regulated intramembrane proteolysis and alginate production, which are critical components of biofilm formation and structural integrity. Future research should specifically examine PA3649 expression and activity under spaceflight conditions to determine its contribution to microgravity-induced phenotypic changes.

What are the optimal expression systems for producing recombinant PA3649 (MucP) for structural and functional studies?

Based on the available research data, successful expression of recombinant PA3649 (MucP) requires careful consideration of several factors:

Expression System Selection:

  • E. coli systems: While not explicitly detailed in the search results, standard E. coli systems (BL21, Rosetta) with T7 promoters would be appropriate for expressing individual domains like the PDZ domains that have been successfully crystallized .

  • P. aeruginosa systems: For functional studies, expression in the native host using vectors like pLAFR3 or IPTG-inducible systems has proven effective .

Expression Control:

  • Inducible promoters: The P trc promoter with IPTG induction has been successfully used, demonstrating that controlled expression is critical as even the inherent leakiness of this promoter produces sufficient MucP to affect phenotypes .

  • Expression level titration: Experimental data shows that MucP function is highly dose-dependent, with optimal function at lower expression levels and inhibitory effects at higher levels . Titration experiments using varied IPTG concentrations (0-1 mM) are essential to determine optimal expression conditions.

Protein Purification Considerations:

  • Given the membrane-integrated nature of full-length MucP with its four transmembrane domains, detergent solubilization protocols would be necessary for purification of the intact protein.

  • Individual domains like the PDZ domains can be expressed and purified independently, as evidenced by the successful crystallization of the PDZ1 domain .

What techniques are most effective for analyzing MucP-mediated proteolysis in vitro and in vivo?

In Vitro Analysis Techniques:

  • Recombinant substrate cleavage assays: Using purified MucP (or domains with proteolytic activity) with fluorogenic peptide substrates derived from known targets like MucA.

  • Site-directed mutagenesis: Modification of the conserved HEXXH zinc-binding motif (positions 21-25) can confirm the metalloprotease mechanism and identify catalytically essential residues .

  • Protease inhibitor profiling: Testing the effects of various protease inhibitors (especially metalloproteases inhibitors) on MucP activity can confirm its classification and mechanism.

In Vivo Analysis Techniques:

  • Genetic complementation assays: The restoration of the mucoid phenotype in mucP mutants by plasmid-based expression provides a visual and quantifiable readout of MucP function .

  • Carbazole alginate quantification: This colorimetric assay provides precise measurements of alginate production as a downstream indicator of MucP activity .

  • Epistasis analysis: By combining mutations or controlled expression of genes in the AlgO/MucP and MucE/AlgW pathways, researchers can determine the hierarchical relationships between these components .

  • Reporter fusions: Linking AlgT/U-responsive promoters to reporter genes can provide real-time readouts of MucP-mediated signaling pathway activation.

How do researchers reconcile the seemingly contradictory effects of MucP overexpression on alginate production?

The paradoxical observation that MucP overexpression can decrease rather than increase alginate production in mucoid strains requires careful interpretation. Research data shows that alginate production in MucP-complemented mutants is highest at 0 mM IPTG (when only leaky expression occurs) and decreases with increasing IPTG concentrations, suggesting an optimal threshold for MucP activity .

Several hypotheses may explain this phenomenon:

  • Substrate depletion: Excessive MucP may rapidly deplete its substrates, leading to pathway shutdown.

  • Negative feedback mechanisms: Overabundant MucP could trigger compensatory regulatory mechanisms that suppress alginate production.

  • Sequestration effects: High concentrations of MucP might sequester critical interaction partners away from their functional locations.

  • Altered protein quality control: Excess MucP could overwhelm cellular quality control mechanisms, leading to misfolded or mislocalized protein.

To resolve these contradictions, researchers should:

  • Conduct time-course experiments to determine if the inhibitory effects are transient or sustained

  • Examine MucP localization under different expression levels

  • Analyze the complete proteolytic cascade with quantitative proteomics to identify rate-limiting steps

  • Investigate potential feedback loops in the AlgT/U regulatory network

What are the most promising directions for future research on PA3649 (MucP)?

Based on current knowledge, several high-priority research directions emerge:

  • Structure-function relationships: While the PDZ1 domain structure is available , obtaining structures of other domains or the full-length protein would significantly advance understanding of MucP's mechanism.

  • Environmental regulation: Investigating how spaceflight and other environmental stressors modulate MucP activity and contribute to biofilm formation could reveal new regulatory mechanisms .

  • Therapeutic targeting: Given MucP's critical role in alginate production and the mucoid phenotype associated with chronic P. aeruginosa infections, developing inhibitors that specifically target MucP might represent a novel anti-virulence strategy.

  • Systems biology approach: Integrating proteomic, transcriptomic, and metabolomic data to place MucP in its broader regulatory context would help clarify its role in coordinating P. aeruginosa adaptation.

  • Host-pathogen interactions: Examining how host factors might influence MucP activity during infection could reveal new aspects of P. aeruginosa pathogenesis.

Research AreaCurrent KnowledgeKey QuestionsRecommended Approaches
Structural BiologyCrystal structure of PDZ1 domain available What is the structure of the full transmembrane protein?Cryo-EM, membrane protein crystallization
Regulatory MechanismsTwo RIP pathways identified (AlgO/MucP and MucE/AlgW) How are these pathways integrated and regulated?Genetic epistasis, quantitative proteomics
Environmental ResponseLimited data on MucP in spaceflight conditions How does MucP respond to environmental stressors?Transcriptomics under varied conditions
Therapeutic PotentialMucP is critical for mucoid phenotype Can MucP be targeted to prevent chronic infections?Small molecule screening, peptide inhibitors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.