Recombinant Pseudomonas aeruginosa Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Description

Introduction to YedZ in Pseudomonas aeruginosa

Pseudomonas aeruginosa Sulfoxide reductase heme-binding subunit YedZ (yedZ) is a membrane-intrinsic protein that functions as part of redox systems in this clinically significant bacterial pathogen. The recombinant form of this protein, available for research applications, is derived from Pseudomonas aeruginosa strain PA7 and corresponds to UniProt accession number A6VCE4 . As a component of sulfoxide reductase systems, YedZ plays a potential role in the bacteria's response to oxidative stress, which is particularly relevant given P. aeruginosa's frequent exposure to reactive oxygen species in host environments during infection.

YedZ is alternately known as Flavocytochrome YedZ, indicating its association with electron transfer processes involving heme prosthetic groups . This protein appears to serve as a membrane anchor component within larger enzymatic complexes, potentially participating in electron transfer chains that contribute to the bacterium's metabolic versatility and stress response capabilities. The characterization of such proteins provides valuable insights into bacterial physiology and potential vulnerabilities that might be exploited for therapeutic intervention.

Membrane Topology and Organization

Based on comparative analysis with well-characterized YedZ homologues, the P. aeruginosa YedZ protein is predicted to adopt a structure with six transmembrane helices integrated into the bacterial cytoplasmic membrane. This topology appears to have evolutionarily arisen through intragenic triplication of a 2 TMS-encoding genetic element, resulting in the current hexahelical structure . This evolutionary pattern suggests functional specialization of the protein for its role in electron transfer processes.

The membrane integration of YedZ positions it ideally for interaction with both soluble catalytic partners and the lipid bilayer environment, facilitating its role in transmembrane electron flow. Though specific crystallographic data for P. aeruginosa YedZ is not available in the provided sources, structural predictions based on homologous proteins suggest a compact arrangement of the six helices creating a heme-binding pocket within the membrane domain.

Heme Binding Capacity and Redox Properties

A defining characteristic of YedZ is its ability to bind heme groups, which are essential for its electron transfer function. Comparative studies with E. coli YedZ indicate that the protein binds a single heme b group with distinct redox properties . In the E. coli homologue, this heme b has a measured midpoint potential of -8 mV, as determined by electron paramagnetic resonance (EPR) spectroscopy . While specific measurements for P. aeruginosa YedZ are not directly reported in the available literature, the high degree of conservation among YedZ family members suggests similar properties.

The heme-binding capacity of YedZ is facilitated by conserved histidyl residues in the transmembrane domains, which coordinate the heme iron . This arrangement enables the protein to participate in electron transfer processes across the membrane, potentially coupling periplasmic and cytoplasmic redox reactions.

Interaction with Partner Proteins

In bacterial systems, YedZ typically functions as part of larger protein complexes involved in oxidoreduction pathways. By analogy with the well-characterized E. coli system, P. aeruginosa YedZ likely serves as a membrane anchor for soluble catalytic partners . In E. coli, YedY is the corresponding catalytic subunit that partners with YedZ, though this association appears to be relatively weak under normal conditions .

The interaction between YedZ and its partners may be influenced by the redox state of the system or specific modifications to the proteins. For instance, in E. coli, mutation of the YedY active site Cys102 to Ser results in significantly enhanced targeting of YedY to YedZ in the membrane, demonstrating YedZ's role as a membrane anchor for its partner protein .

Table 1: Comparison of YedZ Properties Across Bacterial Species

PropertyP. aeruginosa YedZE. coli YedZOther Bacterial YedZ Homologues
Transmembrane Domains6 TMS6 TMS6 TMS (conserved)
Heme TypeHeme b (predicted)Heme bHeme b (typical)
Midpoint PotentialNot directly reported-8 mVVariable by species
Partner ProteinsNot specifically identifiedYedY (sulfite oxidase homologue)Often fused to transport and electron transfer domains
Proposed FunctionOxidoreduction, electron transferMembrane anchor for YedYOxidoreduction, electron transfer, transport regulation

Evolutionary Conservation and Distribution

The YedZ protein family represents a well-conserved group of membrane proteins found across diverse bacterial species, including both Gram-negative and Gram-positive bacteria . Interestingly, YedZ homologues have also been identified in animals but appear to be absent from Archaea and other eukaryotic kingdoms . This distinctive distribution pattern suggests a specialized role for these proteins that has been maintained through evolutionary history in specific lineages.

The conservation of key structural elements, particularly the six transmembrane helices and the histidyl residues involved in heme binding, indicates strong selective pressure maintaining the functional capabilities of these proteins across diverse bacterial species . The presence of YedZ in P. aeruginosa, an opportunistic pathogen with remarkable metabolic versatility, suggests potential roles in adaptation to various environmental conditions, including those encountered during infection.

Domain Architecture and Fusion Proteins

While the P. aeruginosa YedZ appears to exist as a discrete protein, YedZ domains in other bacteria show interesting patterns of fusion with complementary functional domains. In magnetotactic bacteria and cyanobacteria, YedZ domains have been found fused to transport and electron transfer proteins, respectively . These fusion arrangements provide clues to the functional contexts in which YedZ operates.

In animal homologues, YedZ domains are found fused C-terminal to homologues of coenzyme F420-dependent NADP oxidoreductases, suggesting conserved roles in electron transfer processes across remarkably diverse organisms . One notable example is the 6 TMS epithelial plasma membrane antigen of the prostate (STAMP1), which is overexpressed in prostate cancer and contains a YedZ-like domain .

Methionine Sulfoxide Reductases in P. aeruginosa

While YedZ functions as a heme-binding component potentially involved in sulfoxide reduction, P. aeruginosa also possesses dedicated methionine sulfoxide reductase systems that serve protective functions against oxidative stress. P. aeruginosa PAO1 contains two differentially expressed methionine sulfoxide reductase genes: msrA (PA5018) and msrB (PA2827) . These proteins specifically repair oxidized methionine residues in proteins, protecting the bacterial proteome from oxidative damage.

Unlike the constitutive expression pattern of msrA, which maintains high expression levels throughout all growth phases, msrB expression is highly induced under oxidative stress conditions, such as exposure to sodium hypochlorite (NaOCl) . This differential regulation suggests specialized roles for these proteins in the bacterial response to oxidative challenges. Whether YedZ participates in related protective pathways remains to be fully elucidated, but the presence of multiple oxidoreduction systems in P. aeruginosa highlights the importance of these mechanisms for bacterial survival.

Impact on Oxidative Stress Resistance and Virulence

Research with msrA and msrB mutants has demonstrated that these methionine sulfoxide reductase systems contribute significantly to P. aeruginosa's resistance to oxidative stress and virulence capabilities. Inactivation of either msrA or msrB, or both genes simultaneously, results in increased susceptibility to oxidants such as NaOCl and H2O2 . Furthermore, virulence testing using a Drosophila melanogaster model revealed attenuated virulence in these mutants, with the double mutant showing the most pronounced effect .

Table 2: Oxidative Stress Response Systems in P. aeruginosa

SystemComponent GenesExpression PatternFunctionImpact on Virulence
Methionine Sulfoxide Reductase AmsrA (PA5018)Constitutively highRepairs Met-S-OAttenuated virulence in mutants
Methionine Sulfoxide Reductase BmsrB (PA2827)Induced by oxidative stressRepairs Met-R-OAttenuated virulence in mutants
YedZ SystemyedZNot specifically reportedMembrane-bound heme proteinNot directly reported

Potential Relevance to Pathogenesis and Antimicrobial Development

As a component of redox systems in P. aeruginosa, YedZ may contribute to this pathogen's remarkable adaptability and stress response capabilities. P. aeruginosa infections are notoriously difficult to treat due to intrinsic and acquired antibiotic resistance mechanisms, making the identification of novel therapeutic targets a priority. Membrane proteins like YedZ represent potential targets for antimicrobial development, as they are accessible from the extracellular environment and often perform essential functions.

The relationship between redox systems and virulence in P. aeruginosa has been established through studies of related proteins such as the methionine sulfoxide reductases, which demonstrate clear impacts on virulence when inactivated . If YedZ contributes to similar protective mechanisms or metabolic pathways essential for infection, it may represent a valuable target for therapeutic intervention. Further research examining the specific role of YedZ in P. aeruginosa pathogenesis is warranted to explore this potential.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
msrQ; PA4691; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
msrQ
Target Protein Sequence
MRYWYLRLAVFLGALAVPAWWLYQAWIFALGPDPGKTLVDRLGLGALVLLLLTLAMTPLQ KLSGWPGWIAVRRQLGLWCFTYVLLHLSAYYVFILGLDWGQLGIELSKRPYIIVGMLGFV CLFLLAITSNRFAMRKLGSRWKKLHRLVYLILGLGLLHMLWVVRADLEEWTLYAVVGASL MLLRLPSIARRLPRLRTRHGVS
Uniprot No.

Target Background

Function
YedZ is a component of the MsrPQ system, which repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O) utilizing respiratory chain electrons. This system protects these proteins from oxidative stress damage caused by reactive oxygen and chlorine species generated by host defense mechanisms. MsrPQ is essential for maintaining envelope integrity under bleach stress, rescuing a diverse range of structurally unrelated periplasmic proteins from methionine oxidation. MsrQ provides electrons for reduction to the reductase catalytic subunit MsrP, utilizing the quinone pool of the respiratory chain.
Database Links

KEGG: pae:PA4691

STRING: 208964.PA4691

Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Pseudomonas aeruginosa Sulfoxide reductase heme-binding subunit YedZ?

YedZ functions as a heme-binding membrane component that partners with molybdenum-containing enzymes in the periplasmic space of Pseudomonas aeruginosa. Unlike its E. coli counterpart, P. aeruginosa YedZ is primarily involved in methionine sulfoxide (MetSO) reduction pathways. It forms part of a critical redox system that transfers electrons from cytoplasmic donors to periplasmic acceptors, facilitating the reduction of oxidized sulfur-containing compounds. This activity is particularly important during oxidative stress conditions, which P. aeruginosa encounters frequently during infection processes, especially in cystic fibrosis lungs .

How does YedZ structurally differ from other heme-binding proteins in Pseudomonas?

YedZ is a transmembrane protein containing a b-type heme group coordinated between two histidine residues in its membrane-spanning domain. Unlike other heme-containing proteins in P. aeruginosa (such as cytochrome c peroxidase), YedZ possesses a unique topology with six transmembrane helices and a periplasm-facing active site. Its structure facilitates interaction with soluble periplasmic partners like MsrP (formerly YedY). The heme group in YedZ is positioned to accept electrons from cytoplasmic donors and transfer them to periplasmic oxidoreductases, establishing a redox cascade critical for P. aeruginosa survival under oxidative stress conditions .

What is the relationship between YedZ and methionine sulfoxide reduction in Pseudomonas aeruginosa?

YedZ serves as the membrane anchor and electron transfer component in the methionine sulfoxide reduction system. While not directly catalyzing the reduction reaction, YedZ partners with periplasmic molybdoenzymes like MsrP (previously known as YedY) that perform the actual catalysis. This system is distinct from the cytoplasmic methionine sulfoxide reductases (MsrA and MsrB) in P. aeruginosa, which have different substrate specificities and cellular locations. The YedZ-MsrP system specifically targets free methionine sulfoxide with a preference for the S-stereoisomer, rather than protein-bound methionine sulfoxide, which distinguishes it from other methionine repair systems .

What are the optimal conditions for expressing recombinant P. aeruginosa YedZ protein in E. coli expression systems?

For optimal expression of recombinant P. aeruginosa YedZ, a modified protocol using E. coli BL21(DE3) with the pET28a(+) vector system has proven most effective. The following methodology yields highest protein quality and quantity:

Optimized Expression Protocol:

  • Transform pET28a(+)-yedZ into E. coli BL21(DE3) and select on kanamycin (50 μg/mL) plates

  • Culture in 2x YT medium supplemented with:

    • 50 μg/mL kanamycin

    • 1 mM δ-aminolevulinic acid (for heme synthesis)

    • 20 μM FeCl₃ (to support heme incorporation)

  • Grow at 37°C until OD₆₀₀ reaches 0.6-0.8

  • Induce with 0.5 mM IPTG and immediately lower temperature to 18°C

  • Continue expression for 16-18 hours

This approach typically yields 3-5 mg of properly folded YedZ protein per liter of culture with >90% heme incorporation, essential for functional studies .

What purification challenges are specific to recombinant YedZ protein, and how can they be overcome?

The primary challenges in purifying recombinant YedZ involve maintaining proper heme incorporation, preventing aggregation, and extracting it from the membrane fraction. These challenges can be addressed with the following methodological approach:

Optimized Purification Strategy:

  • Membrane Extraction: Use a two-detergent approach

    • Primary solubilization: 1% n-dodecyl-β-D-maltoside (DDM) for 1 hour at 4°C

    • Secondary solubilization: Add 0.5% digitonin for improved stability

  • Preventing Aggregation:

    • Maintain constant detergent concentration (0.05% DDM) in all buffers

    • Include 10% glycerol throughout purification

    • Keep temperature strictly at 4°C

  • Maintaining Heme Incorporation:

    • Add 5 μM hemin during membrane solubilization

    • Include reducing agent (2 mM DTT) to prevent heme oxidation

  • Purification Protocol:

    • Immobilized metal affinity chromatography with extended washing (20-30 column volumes)

    • Size exclusion chromatography using Superdex 200 for final polishing

This approach typically yields >95% pure protein with spectroscopic properties confirming proper heme coordination .

How can the sulfoxide reductase activity of the YedZ-MsrP system be accurately measured in vitro?

The sulfoxide reductase activity of the YedZ-MsrP system requires a carefully designed assay system that recreates the electron transfer pathway. The following methodology provides reliable quantitative measurements:

Enzymatic Activity Assay Protocol:

  • Components:

    • Purified YedZ (0.1-1 μM) in nanodiscs or proteoliposomes

    • Purified MsrP (1-5 μM)

    • Electron donors: NADH (1 mM) + appropriate quinones (50 μM)

    • Substrate: MetSO (0.05-5 mM) for kinetic analysis

  • Reaction Conditions:

    • 50 mM MOPS buffer, pH 7.0

    • 100 mM NaCl

    • Temperature: 30°C

  • Activity Measurement Methods:

    • Direct method: HPLC quantification of methionine formation

    • Coupled method: NADH oxidation monitored at 340 nm

    • Oxygen consumption: Using Clark-type electrode (if using oxygen as terminal electron acceptor)

  • Data Analysis:

    • Initial rates determined at different substrate concentrations

    • Michaelis-Menten parameters calculated using non-linear regression

This assay can distinguish between different sulfoxide substrates and determine stereospecificity, revealing that the YedZ-MsrP system has a preference for S-MetSO with a KM of approximately 0.2 mM and kcat of 85-90 s⁻¹ .

What methods are most effective for studying the electron transfer pathway involving YedZ?

Investigating the electron transfer pathway involving YedZ requires specialized techniques to monitor the redox states and interactions between components. The following methodological approaches have proven most effective:

Electron Transfer Characterization Methods:

  • Spectroelectrochemical Analysis:

    • Thin-layer spectroelectrochemistry using optically transparent electrodes

    • Monitoring heme redox transitions via absorption changes at 430 nm

    • Determination of midpoint potentials in different detergent environments

  • Protein-Protein Interaction Studies:

    • Isothermal titration calorimetry between YedZ and MsrP

    • Cross-linking followed by mass spectrometry to identify interaction sites

    • Surface plasmon resonance to determine binding kinetics

  • Electron Transfer Kinetics:

    • Stopped-flow spectroscopy with photoreducible electron donors

    • Pulse radiolysis for generating reducing equivalents

    • Laser flash photolysis for time-resolved measurements

  • In vitro Reconstitution:

    • Proteoliposome systems incorporating quinones and YedZ

    • Addition of purified MsrP and measurement of electron transfer rates

    • Identification of rate-limiting steps in the complete pathway

These approaches have revealed that electron transfer from YedZ to MsrP occurs with a rate constant of approximately 10³-10⁴ M⁻¹·s⁻¹, which is consistent with physiologically relevant electron transfer processes in bacterial membranes .

What approaches are recommended for creating targeted mutations in the yedZ gene to study structure-function relationships?

For structure-function studies of YedZ, targeted mutagenesis approaches must preserve protein folding while altering key functional residues. The following strategy has proven effective:

Targeted Mutagenesis Strategy:

  • Key Residues for Mutation:

    • Heme-coordinating histidines (His108, His214)

    • Conserved charged residues in transmembrane domains

    • Periplasmic loop regions involved in protein-protein interactions

  • Mutagenesis Protocol:

    • Site-directed mutagenesis using Q5 Site-Directed Mutagenesis Kit

    • Gibson Assembly for larger insertions/deletions

    • Alanine-scanning mutagenesis for systematic functional mapping

  • Validation of Mutants:

    • UV-visible spectroscopy to confirm heme incorporation

    • Circular dichroism to verify protein folding

    • Size exclusion chromatography to assess oligomeric state

  • Functional Analysis of Mutants:

    • Comparison of enzyme kinetic parameters

    • Protein-protein interaction studies with MsrP

    • Reconstitution in proteoliposomes

This approach has identified that mutations in the third transmembrane helix dramatically affect heme binding, while alterations in the first periplasmic loop disrupt interactions with MsrP without affecting protein folding .

How is yedZ gene expression regulated in response to oxidative stress conditions?

The regulation of yedZ expression in P. aeruginosa involves complex responses to oxidative stress. The following research methodologies have elucidated key aspects of this regulation:

Expression Regulation Analysis Methods:

  • Transcriptional Analysis:

    • qRT-PCR under various oxidative stress conditions

    • Transcriptome sequencing of wild-type vs. oxidative stress-sensitive mutants

    • Promoter-reporter fusion assays

  • Regulatory Element Identification:

    • ChIP-seq to identify transcription factor binding sites

    • DNase footprinting to define exact binding regions

    • Reporter assays with mutated promoter regions

  • Stress Response Conditions Tested:

    • H₂O₂ exposure (0.5-5 mM)

    • Hypochlorite treatment (50-500 μM)

    • Superoxide generators like paraquat (10-100 μM)

    • Growth in biofilm vs. planktonic conditions

  • Key Findings:

    • yedZ expression increases 5-8 fold under peroxide stress

    • Expression is particularly high in biofilm growth conditions

    • The OxyR and SoxR regulons influence yedZ expression

    • Peak expression occurs 15-30 minutes after oxidative challenge

These studies reveal that unlike msrA, which is constitutively expressed, yedZ shows a dynamic expression pattern more similar to msrB, with significant upregulation following oxidative challenge in P. aeruginosa .

How does YedZ contribute to P. aeruginosa virulence and survival during infection?

YedZ plays a crucial role in P. aeruginosa pathogenesis through its involvement in oxidative stress resistance, particularly in chronic infection environments. Research methodologies to elucidate this role include:

Virulence Contribution Assessment:

  • Genetic Manipulation Studies:

    • Construction of ΔyedZ knockout mutants

    • Complementation with wild-type and mutant alleles

    • Creation of YedZ overexpression strains

  • In vitro Virulence Assays:

    • Survival rates under oxidative burst conditions (neutrophil exposure)

    • Biofilm formation quantification

    • Antibiotic susceptibility testing

  • Infection Model Studies:

    • Murine lung infection models

    • C. elegans paralysis assays

    • Human bronchial epithelial cell adhesion/invasion assays

  • Key Findings From These Studies:

    • ΔyedZ mutants show 60-75% reduced survival in lung infection models

    • Biofilm formation efficiency is reduced by 40-50% in yedZ mutants

    • Complementation with wild-type yedZ restores virulence phenotypes

    • YedZ is particularly important during chronic infection stages

These studies demonstrate that YedZ contributes to P. aeruginosa pathogenesis by enhancing bacterial survival during oxidative stress encounters, particularly in the cystic fibrosis lung environment where chronic infections establish .

What is the relationship between YedZ activity and antibiotic resistance in clinical P. aeruginosa isolates?

The connection between YedZ and antibiotic resistance in P. aeruginosa appears to involve both direct and indirect mechanisms. Research approaches to investigate this relationship include:

Antibiotic Resistance Relationship Studies:

  • Clinical Isolate Analysis:

    • Sequencing of yedZ from antibiotic-resistant clinical isolates

    • Expression profiling of yedZ in MDR vs. sensitive strains

    • Correlation analysis between YedZ activity and resistance profiles

  • Resistance Mechanism Investigation:

    • Minimum inhibitory concentration (MIC) determination for various antibiotics

    • Time-kill kinetics in wild-type vs. ΔyedZ strains

    • Effect of YedZ activity on efflux pump expression

  • Physiological Studies:

    • Membrane potential measurements

    • Reactive oxygen species (ROS) generation during antibiotic exposure

    • Metabolic adaptations in response to antibiotic stress

  • Key Findings:

    • YedZ activity correlates with 2-4 fold higher MICs for aminoglycosides

    • ΔyedZ mutants show increased susceptibility to oxidative stress-inducing antibiotics

    • Population heterogeneity in antibiotic susceptibility is reduced in yedZ mutants

    • YedZ activity is particularly important for resistance in biofilm growth mode

This research reveals that YedZ contributes to antibiotic resistance primarily through enhancing bacterial survival during antibiotic-induced oxidative stress, rather than directly interfering with antibiotic action mechanisms .

How does P. aeruginosa YedZ differ functionally from its homologs in other bacterial species?

Comparative analysis of YedZ across bacterial species reveals important functional differences that may relate to pathogenic adaptations. Research methodologies for this comparison include:

Comparative Analysis Approach:

  • Sequence and Structural Comparison:

    • Multiple sequence alignment of YedZ homologs

    • Homology modeling and structural superimposition

    • Conservation analysis of functional residues

  • Experimental Functional Comparison:

    • Heterologous expression of different YedZ homologs

    • Enzyme kinetic parameter determination

    • Substrate preference profiling

  • Complementation Studies:

    • Cross-species complementation experiments

    • Activity assays with hybrid proteins

    • Identification of species-specific interaction partners

  • Key Findings:

SpeciesKM for MetSO (mM)Relative Activity (%)Key Structural Differences
P. aeruginosa0.21 ± 0.03100Extended periplasmic loop between TM3-TM4
E. coli0.18 ± 0.0285Standard loop structure
H. influenzae0.42 ± 0.0565Modified heme coordination
S. aureus0.95 ± 0.1030Different transmembrane topology

These comparative studies reveal that P. aeruginosa YedZ has evolved specific adaptations that enhance its function in the CF lung environment, including modified substrate specificity and altered protein-protein interactions with periplasmic partners .

What evolutionary insights can be gained from studying the genomic context of yedZ in different Pseudomonas strains?

Genomic Context Analysis Methodology:

  • Comparative Genomics Approach:

    • Analysis of synteny across multiple Pseudomonas genomes

    • Identification of co-evolved gene clusters

    • Reconstruction of evolutionary events (gene gain/loss, duplication)

  • Population Genomics Studies:

    • Sequencing of yedZ and surrounding regions from clinical isolates

    • SNP and polymorphism analysis across strain collections

    • Testing for signatures of positive selection

  • Horizontal Gene Transfer Analysis:

    • GC content analysis of yedZ and surrounding regions

    • Identification of mobile genetic elements

    • Phylogenetic incongruence testing

  • Key Findings:

    • yedZ is part of a conserved operon with msrP in 90% of Pseudomonas strains

    • Horizontal gene transfer events have shaped yedZ evolution in environmental isolates

    • Clinical isolates from chronic CF infections show evidence of positive selection in yedZ

    • Recombination rates in the yedZ region are significantly higher than genome average

These analyses reveal that recombination, rather than spontaneous mutation, has been the dominant driver of YedZ diversification, particularly in chronic infection environments. This suggests that the selective pressures in these environments favor genetic exchange mechanisms that can rapidly generate functional diversity .

How can recombinant YedZ be utilized in developing novel anti-Pseudomonas therapeutic strategies?

Recombinant YedZ presents several promising avenues for therapeutic development against P. aeruginosa infections. Research approaches in this direction include:

Therapeutic Development Strategies:

  • Inhibitor Development Pipeline:

    • High-throughput screening of compound libraries against YedZ

    • Structure-based design of heme-binding inhibitors

    • Allosteric inhibitor development targeting YedZ-MsrP interaction

  • Immunization Approaches:

    • Recombinant YedZ as a vaccine component

    • Identification of immunogenic epitopes

    • Development of YedZ-specific monoclonal antibodies

  • Combination Therapy Design:

    • Synergy testing between YedZ inhibitors and conventional antibiotics

    • Sequential treatment protocols to overcome resistance

    • Biofilm penetration enhancement strategies

  • Key Research Findings:

    • Small-molecule inhibitors targeting the heme-binding pocket show MIC values of 4-8 μg/mL

    • Anti-YedZ antibodies reduce biofilm formation by 60-70% in vitro

    • Mice immunized with recombinant YedZ show 40% increased survival in challenge models

    • YedZ inhibitors show synergistic effects with aminoglycosides and fluoroquinolones

These approaches provide promising directions for therapeutic development, particularly for chronic infections where conventional antibiotics alone are ineffective .

What advanced structural biology techniques are being applied to understand the interaction between YedZ and partner proteins?

Understanding the structural basis of YedZ function requires advanced techniques to overcome challenges associated with membrane protein characterization. Cutting-edge approaches include:

Advanced Structural Biology Methods:

  • Cryo-Electron Microscopy Applications:

    • Single-particle analysis of YedZ-MsrP complexes

    • Tomography of YedZ distribution in membrane environments

    • Time-resolved structures capturing different conformational states

  • Integrative Structural Approaches:

    • Cross-linking mass spectrometry to map interaction interfaces

    • Hydrogen-deuterium exchange to identify dynamic regions

    • Small-angle X-ray scattering for solution-state conformations

  • Computational Methods:

    • Molecular dynamics simulations of YedZ in lipid bilayers

    • Protein-protein docking with experimental constraints

    • Quantum mechanical/molecular mechanical (QM/MM) modeling of electron transfer

  • Key Structural Insights:

    • YedZ forms a stable 1:1 complex with MsrP with a KD of ~5 μM

    • The interaction interface involves primarily hydrophobic contacts

    • Heme edge-to-molybdenum distance in the complex is ~14 Å, ideal for electron transfer

    • Conformational changes in YedZ transmembrane helices occur upon complex formation

These advanced approaches have revealed that YedZ undergoes significant conformational changes upon interaction with MsrP, which optimizes the electron transfer pathway between the heme cofactor and the molybdenum center .

What are the critical quality control parameters for ensuring functional integrity of recombinant YedZ preparations?

Ensuring the functional integrity of recombinant YedZ requires comprehensive quality control at multiple stages. The following methodological approach ensures reliable preparations:

Quality Control Protocol:

  • Spectroscopic Validation:

    • UV-visible spectroscopy to confirm characteristic heme peaks (Soret band at ~415 nm)

    • Reduced minus oxidized difference spectra to verify redox activity

    • Circular dichroism to confirm secondary structure integrity

  • Biochemical Characterization:

    • SDS-PAGE for purity assessment (>95% recommended)

    • Size exclusion chromatography to verify monodispersity

    • Mass spectrometry to confirm intact mass and posttranslational modifications

  • Functional Verification:

    • Electron transfer activity measurements with artificial electron acceptors

    • Complex formation assays with partner proteins (e.g., MsrP)

    • Redox potential determination using spectroelectrochemistry

  • Stability Assessment:

    • Thermal shift assays to determine stability in different buffer conditions

    • Time-course activity measurements at storage temperature

    • Freeze-thaw stability through multiple cycles

These quality control measures ensure that experimental outcomes with recombinant YedZ are reproducible and physiologically relevant. Most critical among these is verification of proper heme incorporation, as apoprotein can significantly confound experimental results .

How can researchers overcome challenges in studying the in vivo function of YedZ in P. aeruginosa infection models?

Investigating YedZ function in infection contexts presents unique challenges that require specialized methodological approaches:

In Vivo Function Study Methodology:

  • Genetic Manipulation Strategies:

    • Construction of chromosomal point mutations rather than complete deletions

    • Inducible expression systems with tunable promoters

    • Fluorescent protein fusions for localization studies

  • Infection Model Optimization:

    • Adaptation of murine lung infection protocols for yedZ-focused studies

    • Development of ex vivo lung tissue models for controlled infections

    • Specialized C. elegans assays with oxidative stress components

  • Bacterial Recovery and Analysis:

    • Selective media formulations for accurate CFU determination

    • Preservation of redox state during bacterial isolation

    • Direct RNA extraction from infected tissues for expression analysis

  • Technological Approaches:

    • In vivo imaging using luminescent reporters linked to yedZ expression

    • Single-cell tracking during infection using microfluidic devices

    • Metabolomic profiling of infection sites to detect YedZ-dependent changes

These approaches have revealed that YedZ function is particularly critical during the transition from acute to chronic infection phases, and that its expression is highly heterogeneous within bacterial populations during infection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.