Recombinant Pseudomonas aeruginosa Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To ensure a specific tag type, please inform us, and we will prioritize its development.
Synonyms
pilD; xcpA; PA4528; Prepilin leader peptidase/N-methyltransferase; Protein PilD; Protein secretion protein XCPA [Includes: Leader peptidase; Prepilin peptidase; N-methyltransferase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
pilD
Target Protein Sequence
MPLLDYLASHPLAFVLCTILLGLLVGSFLNVVVHRLPKMMERNWKAEAREALGLEPEPKQ ATYNLVLPNSACPRCGHEIRPWENIPLVSYLALGGKCSSCKAAIGKRYPLVELATALLSG YVAWHFGFTWQAGAMLLLTWGLLAMSLIDADHQLLPDVLVLPLLWLGLIANHFGLFASLD DALFGAVFGYLSLWSVFWLFKLVTGKEGMGYGDFKLLAMLGAWGGWQILPLTILLSSLVG AILGVIMLRLRNAESGTPIPFGPYLAIAGWIALLWGDQITRTYLQFAGFK
Uniprot No.

Target Background

Function
This protein plays a critical role in type IV pili and type II pseudopili formation. Its function involves the proteolytic removal of leader sequences from substrate proteins, followed by the monomethylation of the alpha-amino group of the newly exposed N-terminal phenylalanine. Substrates include proteins essential for pilus biogenesis (PilE, PilV, PilW, and PilX), as well as components of the type II general secretory apparatus (GspG, GspH, GspI, and GspJ).
Database Links

KEGG: pae:PA4528

STRING: 208964.PA4528

Protein Families
Peptidase A24 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of pilD in Pseudomonas aeruginosa?

PilD functions as a bifunctional enzyme essential for P. aeruginosa pathogenicity and cellular processes. Primarily, PilD acts as a pilin-specific leader peptidase responsible for posttranslational modification of pilin monomers, which is critical for assembly of pilus organelles . This prepilin processing activity enables the formation of Type IV pili, which are vital for bacterial adhesion, motility, and virulence.

Beyond pilus formation, PilD controls the export of multiple virulence factors including alkaline phosphatase, phospholipase C, elastase, and exotoxin A . Research demonstrates that pilD mutants accumulate these proteins in the periplasmic space while maintaining normal secretion of periplasmic and outer membrane proteins. This indicates that PilD's function extends specifically to specialized protein secretion pathways rather than affecting general protein export mechanisms.

Investigation of pilD mutants has revealed that exotoxin A accumulates in the periplasm in a fully mature form, containing all cysteines in disulfide bonds and maintaining cytotoxicity in tissue culture assays . This suggests that PilD likely functions as a protease involved in processing and assembly of components within the membrane machinery necessary for the later stages of protein extracellular localization, rather than affecting protein folding or maturation.

How does pilD relate to Type IV pili assembly?

Type IV pili (T4P) assembly in P. aeruginosa requires a coordinated system of proteins, with PilD serving as a critical component in this complex machinery. The assembly pathway involves three key accessory proteins: PilB, PilC, and PilD, which work together to facilitate the biogenesis of functional pili . Within this system, PilD specifically functions as the leader peptidase that processes prepilin monomers before their incorporation into the pilus structure.

The assembly process begins with PilD cleaving the leader sequence from prepilin molecules, a crucial posttranslational modification that prepares these subunits for polymerization. Without functional PilD, bacteria cannot form proper pilus structures, resulting in significant impacts on bacterial motility, adhesion capabilities, and virulence factors. Notably, while PilB and PilC also participate in pilus biogenesis, their roles appear more specialized to pilus assembly specifically, as mutations in these genes do not lead to the broader secretion defects observed in pilD mutants .

Recent research has further elucidated a complex regulatory network involving additional proteins such as PilZ and PlzR that modulate Type IV pili assembly. These proteins form a novel interaction complex with PilB in P. aeruginosa , suggesting multilayered regulation of the pilus assembly process that potentially intersects with PilD's function. For example, studies have demonstrated that specific residues like W72 in PilZ are critical for PilZ-PilB interaction , highlighting the molecular specificity in these regulatory networks.

What is the structural characterization of pilD?

The structural characterization of PilD represents an ongoing area of research interest due to the protein's multifunctional nature and importance in bacterial pathogenicity. PilD is classified as a membrane-associated peptidase that belongs to a specialized family of processing enzymes. Though complete high-resolution structures are still under investigation, functional analyses have provided insights into critical domains and motifs.

Studies focusing on recombinant protein expression approaches indicate that obtaining properly folded PilD presents significant challenges, similar to those encountered with other membrane-associated proteins. Researchers have emphasized the importance of refolding processes that preserve native-like secondary and tertiary structures, as improper folding can substantially impair functional characterization . This underscores the critical nature of protein conformation in PilD activity studies.

What are the optimal methods for cloning and expressing recombinant pilD?

Successful cloning and expression of recombinant pilD requires careful optimization of multiple parameters. Based on comparable approaches with similar proteins, researchers should consider the following methodology:

For gene amplification, design specific oligonucleotides based on the pilD sequence from reference P. aeruginosa strains, incorporating appropriate restriction sites to facilitate cloning. Similar to approaches used for pilS , restriction sites such as BamHI and HindIII can be added to forward and reverse primers, respectively. An initial cloning step into an intermediate vector such as pGEM-T Easy can improve stability before subcloning into an expression vector system.

For expression, the pET28a vector with BL21(DE3) E. coli strains has demonstrated effectiveness for similar proteins . This system provides controllable expression through IPTG induction and incorporates histidine tags for purification. Expression conditions typically require optimization of:

  • Temperature (18-25°C often preferred over 37°C)

  • Induction time (4-16 hours)

  • IPTG concentration (0.1-1.0 mM)

These parameters should be systematically tested to maximize soluble protein yield while minimizing inclusion body formation.

Given pilD's membrane-associated nature, expression strategies that incorporate solubility-enhancing fusion partners (such as MBP or SUMO) or target the protein to the periplasmic space may significantly improve proper folding. For particularly challenging constructs, specialized E. coli strains designed for membrane protein expression or those containing additional chaperones may prove beneficial for obtaining functionally active recombinant pilD.

How can researchers effectively purify recombinant pilD?

Purification of recombinant pilD presents several challenges due to its membrane association and complex tertiary structure. An effective purification strategy requires careful consideration of protein solubility, stability, and functional integrity throughout the process.

For initial protein capture, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin provides efficient separation when pilD is expressed with histidine tags. Buffer optimization is critical—buffers containing 20-50 mM Tris-HCl or sodium phosphate (pH 7.5-8.0), 150-300 mM NaCl, and 10-20% glycerol help maintain protein stability. The addition of mild detergents such as 0.1% Triton X-100 or 0.5% CHAPS may improve solubilization while preserving protein structure.

If pilD forms inclusion bodies despite optimization, a refolding strategy becomes necessary. Following solubilization with denaturants like 6-8 M urea or guanidine hydrochloride, gradual removal of the denaturant through dialysis or dilution in the presence of stabilizing agents (l-arginine, glycerol, and low concentrations of detergents) can promote proper refolding. As observed with similar proteins, refolding conditions must be carefully optimized to ensure that the recombinant protein maintains native-like secondary and tertiary structures .

For enhanced purity, secondary chromatography steps such as ion exchange chromatography or size exclusion chromatography effectively remove contaminating proteins and aggregates. Throughout all purification steps, functional assays should be employed to monitor activity retention, ensuring the final purified protein maintains its enzymatic capabilities.

What assays are available to measure pilD activity?

Assessing the enzymatic activity of pilD requires specialized assays that can monitor its leader peptidase function and potentially its role in protein secretion. Several complementary approaches provide comprehensive evaluation of recombinant pilD functionality:

Prepilin Processing Assays: The primary function of pilD as a leader peptidase can be assessed using synthetic peptide substrates derived from prepilin sequences. These assays typically employ HPLC or mass spectrometry to detect the cleaved leader peptide or the processed pilin product. Alternatively, recombinant prepilin substrates with fusion tags can be used, where processing by pilD results in tag removal that can be visualized by Western blotting or SDS-PAGE.

In Vivo Complementation Assays: Functionality can be demonstrated through complementation studies using pilD-deficient P. aeruginosa strains. Transformation with plasmids expressing recombinant pilD should restore phenotypes like pilus formation, twitching motility, and protein secretion in these mutants. Similar to approaches used with related pilus proteins, CRISPR-Cas3 systems can be employed to generate precise deletion mutants for complementation testing .

Protein-Protein Interaction Assays: Given pilD's involvement in multiprotein complexes, assessing its interactions with other components of the pilus biogenesis machinery provides valuable functional information. Techniques such as bacterial two-hybrid systems, similar to those used to study PilZ-PilB interactions , can reveal whether recombinant pilD maintains proper binding to its partner proteins.

Electron Microscopy Verification: Ultimate confirmation of pilD activity can be obtained by examining pilus formation through transmission electron microscopy. Successful complementation of pilD mutants should restore the visible surface pili, providing definitive evidence of functional activity.

How does pilD interact with other pilus biogenesis proteins?

PilD functions within a complex network of protein interactions that orchestrate Type IV pilus assembly in P. aeruginosa. Understanding these interactions provides critical insights into the molecular mechanisms underlying pilus biogenesis and potentially reveals new therapeutic targets.

The pilD protein collaborates closely with PilB and PilC, which together form the core machinery necessary for posttranslational modification and assembly of pilin monomers . While PilB and PilC appear specialized for pilus assembly, PilD's broader role suggests differential interaction patterns within this complex. Recent research has identified novel regulatory components of this system, including the PilZ-PlzR interaction complex that modulates PilB function . This raises important questions about whether pilD activity might also be regulated through similar protein-protein interactions.

Experimental approaches to characterizing these interactions include bacterial two-hybrid assays, which have successfully demonstrated that both PlzR and PilB can interact with PilZ simultaneously through different binding surfaces . Similar methodologies could elucidate pilD's interaction partners. Pull-down experiments coupled with mass spectrometry have also proven valuable for identifying components of protein complexes and could reveal pilD-associated proteins.

The table below summarizes key protein-protein interactions in the Type IV pili assembly system based on current research:

ProteinInteraction PartnersDetection MethodFunctional Significance
PilZPilBBacterial two-hybrid Critical for T4P function
PilZPlzRPull-down assays Regulatory complex formation
PilBPilZ-PlzR complexBacterial two-hybrid Simultaneous binding through different interfaces
PilDPilB, PilCGenetic studies Core pilus assembly machinery

Site-directed mutagenesis studies targeting potential interaction domains would help map the specific regions involved in protein-protein binding. For instance, research on PilZ has demonstrated that the W72 residue is critical for PilZ-PilB interaction, while the F52 residue affects protein stability or function . Analogous studies with pilD could identify key residues essential for its interactions within the pilus assembly complex.

What role does pilD play in protein secretion beyond pilus assembly?

PilD exhibits a remarkable dual functionality that distinguishes it from other pilus biogenesis proteins. Beyond its established role in pilus formation, pilD controls the export of multiple virulence factors, including alkaline phosphatase, phospholipase C, elastase, and exotoxin A . This expanded function makes pilD a critical link between pilus assembly and virulence in P. aeruginosa.

Research has demonstrated that pilD mutants accumulate these secreted proteins in the periplasmic space while maintaining normal secretion of periplasmic and outer membrane proteins . This selective effect on protein export suggests that pilD is specifically involved in the terminal stages of extracellular protein secretion. Notably, mutations in pilB and pilC do not produce similar secretion defects, indicating that this function is unique to pilD .

The mechanism through which pilD facilitates protein secretion remains incompletely understood. Current evidence suggests it likely functions as a protease involved in processing and assembly of components within the membrane machinery necessary for the later stages of protein extracellular localization . This could involve the maturation of secretion system components or direct processing of secreted substrates.

Studies have shown that in pilD mutants, exotoxin A accumulates in the periplasm in a fully mature form, containing all cysteines in disulfide bonds and maintaining cytotoxicity in tissue culture assays . This indicates that pilD does not affect protein folding or maturation but specifically blocks the final secretion step, further supporting its role in the terminal stages of the secretion pathway.

How do mutations in pilD affect virulence in P. aeruginosa?

Mutations in pilD have profound and multifaceted effects on P. aeruginosa virulence due to the protein's dual role in pilus assembly and protein secretion. These impacts manifest across several virulence-associated phenotypes, making pilD an important target for understanding pathogenicity.

The absence of functional pilD disrupts Type IV pilus formation, significantly impairing bacterial adhesion to host surfaces, twitching motility, and biofilm formation—all critical factors in establishing infection. Additionally, pilD mutations prevent the secretion of key virulence factors including exotoxin A, which plays a major role in tissue damage during infection .

The combined defects in adherence and toxin secretion significantly attenuate virulence in experimental infection models. This attenuation occurs through multiple mechanisms:

  • Reduced colonization capacity due to impaired adhesion and biofilm formation

  • Diminished host cell damage due to restricted delivery of toxic enzymes

  • Increased susceptibility to host immune clearance due to altered surface properties

  • Compromised bacterial communication and coordination during infection

Methodological approaches for studying these effects include:

  • Isogenic mutant construction using CRISPR-Cas3 systems similar to those employed for related pilus proteins

  • Complementation analysis with wild-type and mutant pilD variants

  • Infection models in tissue culture and animal systems

  • Comprehensive virulence factor secretion profiling

How can researchers resolve expression challenges with recombinant pilD?

Expression of recombinant pilD frequently presents significant challenges due to the protein's membrane association and complex structure. Researchers commonly encounter issues including low expression levels, formation of inclusion bodies, and production of non-functional protein. Systematic troubleshooting approaches can help overcome these obstacles.

When facing poor expression levels, consider the following strategies:

  • Codon optimization: Adapting the pilD sequence to match the codon usage preferences of the expression host can significantly improve translation efficiency.

  • Expression vector selection: Testing multiple vector systems beyond the standard pET28a may identify options that provide better expression control. Vectors with tightly regulated promoters help prevent leaky expression that might be toxic to host cells.

  • Host strain evaluation: Different E. coli strains have varying capabilities for membrane protein expression. Specialized strains like C41(DE3) and C43(DE3), designed specifically for membrane proteins, or strains containing additional rare tRNAs may improve results.

  • Culture conditions optimization: Systematic testing of induction parameters including temperature (typically lowering to 16-25°C), inducer concentration (generally reducing to 0.1-0.5 mM IPTG), and post-induction time (extending to 16-24 hours) often yields substantial improvements.

For inclusion body formation, incorporating solubility-enhancing fusion partners such as MBP, SUMO, or Trx can dramatically improve the proportion of soluble protein. Alternatively, developing effective refolding protocols similar to those used for other fimbrial proteins may be necessary. These typically involve gradual removal of denaturants through dialysis or dilution while maintaining stabilizing agents.

If expressing functionally active protein remains challenging, cell-free expression systems offer an alternative approach that bypasses cellular toxicity issues. These systems can be supplemented with detergents or lipids to create an environment conducive to proper membrane protein folding.

What approaches help resolve contradictory data regarding pilD function?

Researchers investigating pilD occasionally encounter seemingly contradictory results regarding its function, interactions, or effects on bacterial phenotypes. These discrepancies may arise from differences in experimental systems, bacterial strains, or methodological approaches. Several strategies can help reconcile conflicting data and develop a more comprehensive understanding of pilD biology.

Strain-specific variation analysis: P. aeruginosa exhibits considerable strain-to-strain variation. When contradictory results emerge, comparative studies using the same methodologies across multiple reference strains (PAO1, PA14, clinical isolates) can determine whether observed differences represent strain-specific characteristics rather than experimental artifacts.

Complementation with defined mutations: When conflicting phenotypes are observed in pilD mutants, complementation studies using both wild-type pilD and variants with targeted mutations in specific functional domains can help dissect which aspects of pilD function contribute to particular phenotypes. This approach has been productively applied to similar proteins like PilZ, where specific residue mutations (W72A, F52A) revealed distinct functional roles .

Multi-method validation: Employ complementary approaches to verify key findings. For example, protein-protein interactions identified through bacterial two-hybrid assays should be confirmed using alternative methods such as pull-down assays or co-immunoprecipitation . Similarly, phenotypic observations should be validated using multiple independent assays when possible.

Comprehensive environmental condition testing: pilD function may vary under different growth conditions. Systematic evaluation across relevant environmental parameters (temperature, pH, oxygen availability, growth phase) can reveal condition-dependent effects that explain apparently contradictory observations.

Quantitative analysis methods: Moving beyond qualitative observations to quantitative measurements with appropriate statistical analysis helps distinguish biologically significant differences from experimental variation. Techniques such as quantitative PCR for expression analysis, luciferase reporter assays for promoter activity, and quantitative phenotypic assays provide more robust data for comparative studies.

How can researchers validate pilD activity in experimental systems?

Validating the activity of recombinant or native pilD in experimental systems requires multiple complementary approaches to ensure that observed effects genuinely reflect pilD function rather than experimental artifacts. A comprehensive validation strategy includes:

Functional complementation assays: The gold standard for validating pilD activity involves demonstrating that the protein can restore normal phenotypes in pilD-deficient strains. This approach confirms that the protein retains its native functions within the cellular context. For recombinant pilD, transformation of a ΔpilD mutant should restore twitching motility, pilus formation, and normal protein secretion patterns .

In vitro enzymatic activity measurements: Direct biochemical assays measuring pilD's prepilin peptidase activity provide definitive evidence of functionality. These assays typically monitor the cleavage of synthetic peptides or recombinant prepilin substrates, with activity detected through mass spectrometry, HPLC analysis, or gel electrophoresis to visualize the processed products.

Structure-activity relationship studies: Site-directed mutagenesis targeting conserved residues predicted to be involved in catalytic activity or substrate binding should produce predictable effects on pilD function. Loss of activity following mutation of catalytic residues confirms that observed functions depend on pilD's enzymatic activity rather than secondary effects.

Inhibitor sensitivity profiles: Specific inhibitors of peptidase activity should block pilD function in a dose-dependent manner. Correlation between inhibitor concentration, enzymatic activity inhibition, and phenotypic effects provides strong validation of pilD's direct involvement in observed phenomena.

Antibody-based detection methods: Generating and validating specific antibodies against pilD enables confirmation of expression, localization, and potential processing intermediates. Similar to approaches used with PilS , these antibodies can verify that observed phenotypes correlate with the presence of correctly expressed and localized pilD protein.

What are emerging therapeutic applications targeting pilD?

The critical role of pilD in both pilus assembly and virulence factor secretion positions it as an attractive target for novel anti-virulence therapeutics against P. aeruginosa infections. Unlike conventional antibiotics that kill bacteria directly and drive resistance development, pilD inhibitors could attenuate virulence while imposing less selective pressure for resistance.

Current research explores several promising therapeutic approaches:

Small molecule inhibitors: High-throughput screening campaigns have identified compounds that inhibit pilD's peptidase activity. These inhibitors typically target the enzyme's active site, blocking prepilin processing and subsequently disrupting pilus assembly. The dual functionality of pilD makes such inhibitors particularly valuable, as they simultaneously prevent both pilus formation and the secretion of multiple virulence factors .

Peptide-based inhibitors: Structural analysis of prepilin cleavage sites has enabled the design of competitive inhibitors that mimic natural substrates but resist cleavage. These peptides bind pilD's active site with high affinity but cannot be processed, effectively blocking the enzyme's activity. Such peptide-based approaches offer high specificity but face challenges regarding stability and cellular delivery.

Anti-virulence combination therapies: Some of the most promising approaches combine pilD inhibitors with conventional antibiotics or other anti-virulence compounds. Such combinations may achieve synergistic effects, reducing the required antibiotic dose and decreasing selection for resistance while effectively controlling infection.

Evaluating these therapeutic approaches requires sophisticated model systems that accurately reflect the complexity of human infections. Advanced tissue culture models, biofilm systems, and animal infection models are being employed to assess both efficacy and potential toxicity of pilD-targeting therapies before clinical translation.

How is CRISPR-Cas technology being applied to study pilD?

CRISPR-Cas technology has revolutionized genetic manipulation capabilities in P. aeruginosa, offering unprecedented precision for studying pilD function through various innovative applications. These advanced genetic tools provide researchers with powerful methods to dissect pilD's complex roles in bacterial physiology and pathogenesis.

Precise gene knockout generation: CRISPR-Cas3 systems have been successfully employed to create clean deletions in P. aeruginosa, as demonstrated in studies of related pilus components . For pilD research, this approach enables the creation of markerless deletion mutants that avoid polar effects on adjacent genes, providing more reliable phenotypic data than traditional insertion-based mutagenesis.

Domain-specific mutations: Beyond complete gene deletion, CRISPR-based approaches allow researchers to introduce specific mutations that target individual functional domains of pilD. This capability facilitates separation of pilD's dual functions in pilus assembly and protein secretion by selectively disrupting one activity while preserving the other.

Regulated expression systems: CRISPR interference (CRISPRi) techniques provide tunable repression of pilD expression without modifying the genomic sequence. This approach enables dose-dependent studies that reveal how varying levels of pilD activity affect different aspects of bacterial physiology and virulence, potentially identifying threshold effects important for therapeutic targeting.

In vivo infection models: CRISPR technology enables the creation of fluorescently tagged pilD variants that maintain native function, allowing real-time visualization of protein localization and dynamics during infection processes. This capability provides insights into how pilD activity is spatially and temporally regulated during host-pathogen interactions.

Implementation of these CRISPR-based approaches requires careful optimization for P. aeruginosa, including selection of appropriate Cas variants, design of effective guide RNAs with minimal off-target effects, and development of efficient delivery methods for different experimental contexts.

What evolutionary insights have been gained from pilD homologs?

Evolutionary analysis of pilD homologs across bacterial species has provided valuable insights into the protein's fundamental functions, specialization, and potential as a therapeutic target. This comparative approach reveals both conserved elements essential to core functionality and divergent features that may reflect adaptation to specific ecological niches.

PilD belongs to a broader family of type IV prepilin peptidases found across diverse bacterial phyla. Sequence alignment and phylogenetic analysis of these homologs reveal several key evolutionary patterns:

  • A highly conserved catalytic domain containing invariant residues essential for peptidase activity, suggesting strong selective pressure to maintain this core function

  • Variable regions that likely mediate species-specific protein-protein interactions or substrate recognition

  • Divergent regulatory elements in the genes encoding these proteins, reflecting adaptation to different environmental signals

Functional studies comparing pilD homologs from different pathogens have demonstrated interesting specializations. While P. aeruginosa pilD exhibits dual functionality in both pilus assembly and protein secretion , homologs in some other species appear more specialized toward either pilus biogenesis or secretion. This functional divergence provides insights into the evolutionary history of these systems and suggests that the dual role observed in P. aeruginosa may represent a derived trait that enhances virulence through coordinated regulation of multiple pathogenicity mechanisms.

The evolutionary persistence of pilD across numerous bacterial pathogens, despite its surface-exposed nature and potential visibility to host immune systems, suggests that it plays roles essential enough to overcome selective pressure for antigenic variation. This evolutionary conservation further validates pilD as a promising therapeutic target with potentially limited paths to resistance development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.