Recombinant Pseudomonas aeruginosa Ubiquinol oxidase subunit 2 (cyoA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Pseudomonas aeruginosa

cyoA is a subunit of the cytochrome bo₃ ubiquinol oxidase, which catalyzes the transfer of electrons from ubiquinol to oxygen, generating proton gradients for ATP synthesis. This system is one of five terminal oxidases in P. aeruginosa, enabling adaptation to diverse oxygen levels .

Regulatory and Stress-Response Roles

  • RpoT Regulation: In Pseudomonas putida, cyoA expression is upregulated 2.2-fold in rpoT mutants, suggesting RpoT-mediated repression under normal conditions. RpoT regulates efflux pumps and stress-response genes, linking cyoA to solvent tolerance and metabolic homeostasis .

  • Oxidative Stress: cyoA is implicated in balancing redox states during hypoxia or biofilm formation, where oxygen gradients limit electron flow. Its activity supports phenazine-mediated extracellular electron transfer, critical for biofilm persistence .

Gene Expression in rpoT Mutants

Studies in Pseudomonas putida reveal cyoA’s regulation in response to RpoT disruption:

GeneFunctionExpression Change (Fold)
cyoAUbiquinol oxidase subunit II+2.2
cyoBUbiquinol oxidase subunit I+2.3
cyoCUbiquinol oxidase subunit III+2.1

This upregulation correlates with increased sensitivity to solvents like toluene, highlighting cyoA’s interplay with efflux pump systems .

Role in Virulence and Biofilm Formation

  • Pathogenicity: Blocking terminal oxidases (including cyoA) reduces P. aeruginosa’s ability to infect Caenorhabditis elegans, underscoring its importance in establishing infections .

  • Redox Balancing: In biofilms, cyoA may facilitate oxygen reduction or phenazine-mediated electron transfer, maintaining cellular redox homeostasis under low-oxygen conditions .

Applications and Future Directions

Recombinant cyoA serves as a tool for:

  1. Structural Studies: Elucidating heme-binding domains and subunit interactions.

  2. Therapeutic Targets: Developing inhibitors of bacterial respiratory chains, which could bypass antibiotic resistance mechanisms .

  3. Biotechnological Use: Exploring cyoA’s role in biofilm disruption or biofuel production via engineered redox pathways.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cyoA; PA1317; Cytochrome bo(3 ubiquinol oxidase subunit 2; Cytochrome o ubiquinol oxidase subunit 2; Cytochrome o subunit 2; Oxidase bo(3 subunit 2; Ubiquinol oxidase polypeptide II; Ubiquinol oxidase subunit 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-331
Protein Length
Full Length of Mature Protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
cyoA
Target Protein Sequence
CDMTLFNPKGQVGMDERTLIITATLLMLIVVIPVIVMTLAFAWKYRASNTQAEYKPDWHH SNRIEAVVWLVPCVIIAILGWITWESTHKLDPYRPLDSEVKPVTIQAVSLDWKWLFIYPE QGIATVNEIAFPKDTPVNFQITSDSVMNSFFIPQLGSQIYSMAGMMTKLHLIANEEGVFD GISANYSGGGFSGMRFKAIATSEQGFQDWVAKVKAAPASLSIGTYPELVKPSENVPPTYF SSVSPELFGHILTKYEHHGDAKGAAHGEHAGAEHEAAMTGHDMQDMDMQAMQGMKDMKDM HMQPSTQE
Uniprot No.

Target Background

Function
Cytochrome bo(3) ubiquinol terminal oxidase is a key component of the aerobic respiratory chain in *E. coli*, predominantly expressed under high aeration conditions. In addition to electron transfer, it exhibits proton pump activity across the membrane, transporting 2 protons per electron.
Database Links

KEGG: pae:PA1317

STRING: 208964.PA1317

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas aeruginosa Ubiquinol oxidase subunit 2 (cyoA) and what is its function?

The Pseudomonas aeruginosa Ubiquinol oxidase subunit 2 (cyoA) is a critical component of the cytochrome bo(3) ubiquinol oxidase complex, functioning within the bacterial respiratory chain. This protein (UniProt ID: Q9I427) spans amino acids 24-331 in its mature form and participates in electron transfer processes that are essential for bacterial respiration .

In P. aeruginosa, respiratory chain components like cyoA are involved in energy generation through electron transport coupled to proton translocation across the cell membrane. While respiratory complexes in some bacteria function as sodium pumps, research on P. aeruginosa respiratory proteins indicates adaptation toward proton-pumping mechanisms, which may apply to the ubiquinol oxidase complex containing cyoA .

What are the optimal storage and handling conditions for recombinant cyoA protein?

Recombinant cyoA protein requires specific storage conditions to maintain stability and functionality:

Storage ParameterRecommended Condition
Long-term storageStore at -20°C/-80°C
Buffer compositionTris/PBS-based buffer, 6% Trehalose, pH 8.0
Physical formLyophilized powder
ReconstitutionDissolve in deionized sterile water to 0.1-1.0 mg/mL
StabilizerAdd 5-50% glycerol (final concentration)
Short-term storageWorking aliquots stable at 4°C for up to one week
Important notesAliquot upon receipt; avoid repeated freeze-thaw cycles

Proper sample handling is critical for experiments, as repeated freeze-thaw cycles significantly reduce protein activity .

How is the purity of recombinant cyoA protein assessed?

Quality assessment of recombinant cyoA typically employs SDS-PAGE analysis, with commercial preparations generally achieving greater than 90% purity . For research applications requiring higher purity standards, additional chromatographic steps might be necessary, including:

  • Size-exclusion chromatography to remove aggregates

  • Ion-exchange chromatography for charge-based separation

  • Affinity chromatography utilizing the His-tag

  • Western blotting with cyoA-specific antibodies to confirm identity

Researchers should validate protein quality before experimental use, especially for functional assays where contaminants might affect results.

What expression systems are most effective for producing functional recombinant cyoA?

  • Using E. coli strains optimized for membrane protein expression (C41/C43)

  • Testing different promoter systems (T7, tac, araBAD) for optimal expression levels

  • Employing lower induction temperatures (16-25°C) to improve proper folding

  • Utilizing specialized growth media formulations that support membrane protein synthesis

  • Considering alternative expression hosts closer to Pseudomonas for complex proteins

The choice of expression system significantly impacts both yield and functionality of the recombinant protein.

What purification strategies work best for obtaining highly pure, functional cyoA protein?

Purification of recombinant cyoA requires careful consideration of its membrane-associated nature:

  • Cell lysis optimization:

    • Mechanical disruption (sonication, French press)

    • Enzymatic treatments with lysozyme

    • Detergent-based extraction from membranes

  • Affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Optimize imidazole concentrations in washing and elution buffers

  • Detergent considerations:

    • Screen mild detergents (DDM, LDAO, Fos-choline)

    • Maintain critical micelle concentration throughout purification

  • Additional purification:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for final polishing

  • Quality control:

    • SDS-PAGE and western blotting

    • Mass spectrometry to confirm protein identity

For functional studies, researchers should monitor activity throughout purification to ensure the protocol preserves biological function.

How does the structure of cyoA contribute to its function in the respiratory chain?

The primary sequence of P. aeruginosa cyoA provides insights into its structure-function relationship. Analyzing the amino acid sequence (CDMTLFNPKGQVGMDERTLIITATLLMLIVVIPVIVMTLAFAWKYRASNTQAEYKPDWHHSNRIEAVVWLVPCVIIAILGWITWESTHKLDPYRPLDSEVKPVTIQAVSLDWKWLFIYPEQGIATVNEIAFPKDTPVNFQITSDSVMNSFFIPQLGSQIYSMAGMMTKLHLIANEEGVFDGISANYSGGGFSGMRFKAIATSEQGFQDWVAKVKAAPASLSIGTYPELVKPSENVPPTYFSSVSPELFGHILTKYEHHGDAKGAAHGEHAGAEHEAAMTGHDMQDMDMQAMQGMKDMKDMHMQPSTQE) reveals transmembrane domains and potential binding regions .

Computational analyses suggest that cyoA likely contains:

  • Multiple transmembrane helices that anchor the protein in the bacterial membrane

  • Conserved residues involved in electron transfer

  • Potential ubiquinone binding sites

  • Interfaces for interaction with other subunits of the oxidase complex

Understanding these structural features provides insight into how the protein participates in the electron transport chain and contributes to cellular bioenergetics.

What experimental approaches can determine the interaction between cyoA and other respiratory chain components?

Several techniques can elucidate cyoA interactions within the respiratory chain:

  • Co-immunoprecipitation studies:

    • Using antibodies against cyoA to pull down interaction partners

    • Mass spectrometry identification of co-precipitated proteins

  • Crosslinking approaches:

    • Chemical crosslinkers of varying lengths to capture transient interactions

    • Photo-activatable crosslinkers for precise spatial control

  • Blue native PAGE:

    • Isolation of intact respiratory complexes

    • Identification of complex composition through second-dimension SDS-PAGE

  • Proximity labeling:

    • APEX2 or BioID fusion proteins to identify proximal proteins in vivo

    • Spatial mapping of the cyoA interaction network

  • Biophysical techniques:

    • Surface plasmon resonance for binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Microscale thermophoresis for interaction studies in solution

By combining multiple approaches, researchers can build a comprehensive map of cyoA's place within the respiratory machinery.

How can researchers assess the functional activity of recombinant cyoA protein?

Functional characterization of cyoA requires approaches that evaluate its activity within the ubiquinol oxidase complex:

  • Spectrophotometric assays:

    • Monitoring ubiquinol oxidation rates at 275 nm

    • Oxygen consumption measurements using oxygen-sensitive electrodes

    • Cytochrome c reduction assays

  • Reconstitution studies:

    • Incorporation into proteoliposomes or nanodiscs

    • Assessment of proton pumping using pH-sensitive dyes

    • Membrane potential measurements with voltage-sensitive probes

  • Inhibitor studies:

    • Sensitivity testing to known respiratory inhibitors

    • Comparison with inhibitor-resistant mutants

    • Structure-activity relationship analysis

  • Electron transfer kinetics:

    • Stopped-flow spectroscopy for rapid kinetic measurements

    • Temperature dependence studies for activation energy determination

The experimental design should account for the membrane-bound nature of cyoA and its participation in multi-protein complexes.

What are the key challenges in expressing and purifying functional recombinant cyoA protein?

Researchers face several challenges when working with cyoA:

  • Expression hurdles:

    • Potential toxicity to host cells when overexpressed

    • Proper membrane insertion and folding

    • Formation of inclusion bodies

  • Purification obstacles:

    • Selection of appropriate detergents that maintain structure

    • Protein aggregation during concentration steps

    • Loss of essential cofactors during purification

  • Stability concerns:

    • Limited stability outside native membrane environment

    • Activity loss during freeze-thaw cycles

    • Oxidative damage to critical residues

  • Functional assessment:

    • Reconstitution into artificial membrane systems

    • Requirement for other subunits for activity

    • Development of reliable activity assays

Strategies to overcome these challenges include using specialized expression strains, optimizing detergent selection, and developing robust refolding protocols when necessary.

How might cyoA contribute to P. aeruginosa pathogenesis and antibiotic resistance?

The role of respiratory chain components in bacterial pathogenesis extends beyond basic metabolism:

  • Adaptation to host environments:

    • Contribution to survival under oxygen-limited conditions in infection sites

    • Participation in energy generation during pathogenesis

  • Potential resistance mechanisms:

    • P. aeruginosa respiratory complexes show resistance to inhibitors like HQNO, which the bacterium produces as a quorum sensing agent and antibiotic against competing bacteria

    • Structural adaptations in respiratory proteins may confer resistance to certain antibiotics

  • Biofilm formation:

    • Energy metabolism shifts during biofilm development

    • Potential role in maintaining membrane potential required for biofilm processes

  • Persistence mechanisms:

    • Contribution to metabolic flexibility during infection

    • Involvement in adaptation to changing oxygen availability

Understanding these connections could identify cyoA as a potential drug target in combating P. aeruginosa infections.

What structural features distinguish P. aeruginosa cyoA from homologous proteins in other bacterial species?

Comparative analysis of P. aeruginosa respiratory proteins reveals unique adaptations:

  • Cation selectivity:

    • While many bacterial respiratory complexes function as sodium pumps, P. aeruginosa has adapted proton-pumping mechanisms

    • Exit ion channels likely determine this selectivity

  • Inhibitor resistance:

    • P. aeruginosa respiratory complexes show 5-10 times greater resistance to HQNO compared to homologs from other bacterial species

    • Specific sequence differences in binding sites may confer this resistance

  • Structural adaptations:

    • Unique amino acid residues that may contribute to function in the specific environmental niches P. aeruginosa occupies

    • Potential modifications for operation under various oxygen tensions encountered during infection

These distinctive features may represent adaptations to P. aeruginosa's versatile lifestyle as both an environmental organism and a human pathogen.

How can structural information about cyoA inform drug discovery efforts targeting P. aeruginosa?

Structural insights into cyoA offer promising avenues for therapeutic development:

  • Structure-based drug design:

    • Identification of unique binding pockets absent in human proteins

    • Virtual screening of compound libraries against cyoA models

    • Fragment-based approaches to develop novel inhibitors

  • Targeting resistance mechanisms:

    • Understanding how P. aeruginosa respiratory proteins resist inhibition can inform the design of compounds that overcome these adaptations

    • Molecular dynamics simulations can reveal transient binding sites

  • Allosteric modulation:

    • Identification of sites that disrupt protein-protein interactions within the respiratory complex

    • Development of compounds that affect conformational changes required for function

  • Respiratory chain vulnerability:

    • Exploration of synergistic effects between cyoA inhibition and other antimicrobial approaches

    • Identification of conditions that increase reliance on cyoA-containing complexes

Given P. aeruginosa's status as a critical nosocomial pathogen, such approaches could address the urgent need for new antibiotics against this organism.

What is the relationship between cyoA and other unique features of P. aeruginosa metabolism?

The integration of cyoA function with broader P. aeruginosa metabolic networks offers research opportunities:

  • Metabolic flexibility:

    • How cyoA-containing complexes contribute to P. aeruginosa's ability to thrive in diverse environments

    • Connections to anaerobic respiration pathways

  • Quorum sensing integration:

    • Potential regulation of cyoA expression by quorum sensing molecules

    • Reciprocal relationship with production of respiratory inhibitors like HQNO that affect competing bacteria

  • Biofilm physiology:

    • Role in the distinct metabolism of biofilm-embedded bacteria

    • Contribution to antibiotic tolerance in biofilms

  • Stress responses:

    • Involvement in adaptation to oxidative stress

    • Role during nutrient limitation

These interconnections highlight the importance of studying cyoA not in isolation, but as part of the integrated bacterial physiological network.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.