Recombinant Pseudomonas aeruginosa Uncharacterized signaling protein PA3311 (PA3311)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. You may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
PA3311; Uncharacterized signaling protein PA3311
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-783
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
PA3311
Target Protein Sequence
MPFLPGKMPKPAVCRRPATSFHADLAGGSRYLYWKHNATPSPHPRRPRVFRVQGDTAMDW QGLRFLGESPVDGYVLQNCTYSPSLVALAFLVACLAGYTALDMVERVGNSLSHPRLWQWI GAFCLGSGIWATHFVAMLAFHAPIALRYDLPITGLSLLIAVAASYLTMYMTARPRFGLLP CLLAACCIGLGIAAMHYTGMAAMRSVATQYYQPSLFALSVLIAIGAAFTALAAVPYLRGR RSARYRYMKLIASLLLAGAIAAMHFTGMAALVLSVPAGTPLELQASADSLRLGWLTGVLA SAIAACGIWAAWSEKQRERRLSENSRVNALLNQLDHAHASLRQMARYDSLTGLQNRTAFN EVFVQHLENCRLRGKGLAVMFLDLDHFKRINDSLGHDSGDQLLKIVSERIRSVLRDSDVV ARFAGDEFCVLADLTQDHEAHILSQRLMQKMKEPIALDGRTLVMTASVGVSLYPNDGEQC EELLKNAGLALHQSKACGRNNAQFFSRQLLVRATQELQMEEELRQALRDDQLELHYQPIL ALADGEVHQLEALVRWRHPTQGLLGPDRFIGLAEANGMIDQLDDWVLRRACRDLRSLHLA GHERLRVAVNCCASNLGRASLVDEVRHALEQAGLAACFLELEVTEDALMYNIDQTIPLLE RLRELGVSLSIDDFGTGYSSLAYLRRLPLDALKVDRSFIMDIPASQRDMEIAQAIIAMAQ KLHLKVVAEGVETPQQLAFLRENHCELVQGYLFSRPLPLAALEEFLRAYRFDAAPPLRSL NQA
Uniprot No.

Target Background

Database Links

KEGG: pae:PA3311

STRING: 208964.PA3311

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is PA3311 and why is it of research interest?

PA3311 is an uncharacterized signaling protein from Pseudomonas aeruginosa, a highly adaptable opportunistic pathogen. This protein consists of 783 amino acids and contains domains suggesting potential signaling functionality. Despite being annotated in the P. aeruginosa genome, its precise biological function remains largely unknown, making it an interesting target for researchers investigating bacterial signaling pathways, virulence factors, and potential therapeutic targets .

The protein's designation as a "signaling protein" suggests it may play a role in cellular communication or response to environmental stimuli, similar to other characterized signaling proteins in P. aeruginosa such as those involved in quorum sensing or two-component regulatory systems. Understanding its function could provide insights into P. aeruginosa's remarkable adaptability and pathogenicity.

How is recombinant PA3311 typically expressed and purified?

Recombinant PA3311 is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification. The standard expression protocol involves:

  • Cloning the full-length PA3311 gene (1-783aa) into an appropriate expression vector

  • Transforming the construct into E. coli expression strains

  • Inducing protein expression under optimized conditions

  • Harvesting cells and lysing them to release the recombinant protein

  • Purifying the His-tagged protein using immobilized metal affinity chromatography (IMAC)

  • Further purification steps as needed (e.g., size exclusion chromatography)

The purified protein is often lyophilized for long-term storage and stability . This approach leverages the comprehensive P. aeruginosa gene collection, where all individual open reading frames (ORFs) have been successfully PCR-amplified and cloned into recombination-based systems, with four independent isolates archived for each ORF .

What experimental approaches are recommended for functional characterization of PA3311?

Given PA3311's uncharacterized nature, a multi-faceted approach is recommended for functional characterization:

  • Comparative transcriptomics analysis: Develop a transcriptome profile similarity analysis (TPSA) approach similar to that used for other P. aeruginosa regulatory proteins. This would involve comparing transcriptome profiles between wild-type, PA3311 knockout, and PA3311-overexpressing strains to identify genes affected by PA3311 expression levels .

  • DNA-binding studies: If PA3311 functions as a transcriptional regulator (similar to other signaling proteins like PsdR), chromatin immunoprecipitation sequencing (ChIP-seq) can identify its DNA binding sites throughout the genome .

  • Phenotypic characterization: Compare phenotypes (biofilm formation, virulence, antibiotic resistance) between wild-type and PA3311 mutant strains under various conditions.

  • Protein-protein interaction studies: Use pull-down assays, bacterial two-hybrid systems, or co-immunoprecipitation to identify interaction partners.

  • Structural biology approaches: X-ray crystallography or cryo-EM to determine the three-dimensional structure, potentially revealing functional domains.

These approaches should be integrated into a comprehensive research program that investigates PA3311 from multiple angles, as has been successfully done for other regulatory proteins in P. aeruginosa .

How might PA3311 relate to quorum sensing and virulence in Pseudomonas aeruginosa?

While direct evidence linking PA3311 to quorum sensing (QS) is not explicitly stated in the provided literature, a methodological approach similar to that used for the XRE-cupin protein PsdR can be applied to investigate this relationship:

  • QS reporter assays: Construct fluorescent reporters for key QS genes (lasR, rhlR, pqsR) and measure their expression in wild-type, PA3311 knockout, and PA3311-overexpressing strains.

  • QS-controlled metabolite quantification: Measure levels of QS signal molecules (like C4-HSL) and QS-regulated products (pyocyanin, hydrogen cyanide) in PA3311 mutant strains compared to wild-type.

  • Virulence assays: Test the cytotoxicity of PA3311 mutants on host cells to determine if PA3311, like PsdR, functions as a virulence regulator .

For context, studies of PsdR revealed that rather than being a local regulator, it controls a large regulon including genes associated with both QS and non-QS pathways. PsdR was found to directly bind to the promoter for the QS master transcription factor LasR, negatively regulating its expression and influencing QS activation . Similar mechanisms might be at play with PA3311, warranting similar investigative approaches.

What role might PA3311 play in biofilm formation and how can this be studied?

To investigate PA3311's potential role in biofilm formation, researchers should consider the following experimental approach:

  • Comparative biofilm assays: Compare biofilm formation between wild-type and PA3311 mutant strains on different surfaces (e.g., SS316, passivated SS316, and liquid-infused surfaces) using established protocols .

  • Quantitative biofilm analysis: Apply COMSTAT software analysis to measure biofilm parameters such as average thickness and roughness, similar to the approach used in other P. aeruginosa biofilm studies .

  • Statistical analysis: Employ a multivariate analysis of variance to analyze biofilm development data, using the following model:

Yijkv=μ+bi+tj+btij+Rk+BRik+TRjk+BTRijk+ZijkvY_{ijkv} = \mu + b_i + t_j + bt_{ij} + R_k + BR_{ik} + TR_{jk} + BTR_{ijk} + Z_{ijkv}

Where:

  • Y_{ijkv} represents the observed multivariate value (average thickness, roughness)

  • b_i is the effect of bacterial strain

  • t_j is the effect of time

  • bt_{ij} is the interaction between strain and time

  • R_k is the random effect of experimental round

  • Microscopic analysis: Use confocal laser scanning microscopy to visualize biofilm architecture and determine if PA3311 affects structural development.

  • Gene expression analysis: Compare transcriptome profiles of biofilm-grown cells between wild-type and PA3311 mutants to identify differentially expressed genes related to biofilm formation.

This methodical approach allows for robust characterization of PA3311's impact on biofilm development across multiple conditions and timepoints .

What protocols are recommended for analyzing PA3311 expression under different conditions?

To analyze PA3311 expression under different experimental conditions, the following comprehensive protocol is recommended:

  • RNA isolation and qRT-PCR:

    • Extract total RNA from P. aeruginosa cultures grown under diverse conditions

    • Synthesize cDNA using reverse transcriptase

    • Perform qRT-PCR with PA3311-specific primers

    • Normalize expression to appropriate reference genes (e.g., rpoD, proC)

  • Transcriptome analysis:

    • Conduct RNA-seq to obtain genome-wide expression profiles

    • Compare PA3311 expression across conditions using DESeq2 or similar tools

    • Apply transcriptome profile similarity analysis (TPSA) to identify conditions that affect PA3311 expression

  • Protein expression analysis:

    • Develop antibodies against recombinant PA3311 or use the His-tagged version

    • Perform Western blotting to quantify protein levels

    • Consider proteomics approaches for broader protein expression analysis

  • Promoter activity assays:

    • Clone the PA3311 promoter region into a reporter vector (e.g., GFP, luciferase)

    • Measure promoter activity under different conditions

    • Identify environmental factors that regulate PA3311 expression

These methods should be applied across relevant conditions, including:

  • Different growth phases (exponential, stationary)

  • Various nutrient conditions (rich vs. minimal media)

  • Stress conditions (oxidative stress, antimicrobial exposure)

  • Biofilm vs. planktonic growth

  • In vivo-mimicking conditions

How can the P. aeruginosa gene repository be effectively utilized for studies involving PA3311?

The P. aeruginosa gene repository represents a powerful resource for PA3311 research. Here's a methodological approach for leveraging this repository:

  • Accessing the PA3311 clone:

    • Obtain the PA3311 clone from the comprehensive P. aeruginosa PA01 gene collection

    • Verify the sequence integrity of the obtained clone against the reference sequence

    • Consider using one of the four independent isolates archived for each ORF

  • Expression and protein production:

    • Transfer the PA3311 gene into appropriate expression vectors using the recombination-based cloning system

    • Express the protein in suitable host systems (E. coli is commonly used)

    • Optimize expression conditions to maximize yield and solubility

    • Purify the recombinant protein for downstream applications

  • Functional studies:

    • Use the repository to clone PA3311 alongside potential interacting partners

    • Create a panel of constructs with different tags or fusion proteins

    • Generate domain deletion or mutation variants to investigate structure-function relationships

  • High-throughput applications:

    • Utilize the repository for proteome-scale analyses

    • Screen for functional activities through parallel processing

    • Develop network and interaction maps involving PA3311

The gene repository provides access to all 5570 ORFs from the P. aeruginosa genome, with complete sequence verification for one-third of these . This resource facilitates rapid implementation of various experimental approaches without the need to individually clone each gene of interest.

What are appropriate statistical approaches for analyzing experimental data related to PA3311?

For robust statistical analysis of PA3311-related experimental data, the following approaches are recommended:

  • Differential gene expression analysis:

    • For RNA-seq data: Apply DESeq2 or edgeR with appropriate false discovery rate control

    • Define significance thresholds (typically log2(fold change) ≥ 1.0, P < 0.05)

    • Consider batch effect correction when combining multiple experimental rounds

  • Multivariate analysis for complex phenotypes:

    • For biofilm studies: Apply multivariate analysis of variance that accounts for:

      • Fixed factors: bacterial strain, time points

      • Random factors: experimental rounds

      • Repeated measures with appropriate correlation structure (e.g., first-order autoregressive)

    • Transform data (e.g., logarithmic transformation) to stabilize variances when necessary

  • Experimental design considerations:

    • Include biological replicates (minimum of 3-4)

    • Implement technical replicates to assess measurement variation

    • Include appropriate controls (positive, negative, and reference strains)

  • Statistical model example for biofilm experiments:

Yijkv=μ+bi+tj+btij+Rk+BRik+TRjk+BTRijk+ZijkvY_{ijkv} = \mu + b_i + t_j + bt_{ij} + R_k + BR_{ik} + TR_{jk} + BTR_{ijk} + Z_{ijkv}

Where the variables represent strain effects, time effects, interactions, and experimental rounds as described previously .

This statistical framework ensures robust analysis of complex datasets generated in PA3311 research, allowing for reliable identification of significant effects while accounting for experimental variability.

What are the optimal storage and handling conditions for recombinant PA3311?

For optimal stability and activity of recombinant PA3311, the following storage and handling recommendations should be followed:

  • Storage conditions:

    • Store lyophilized protein at -20°C/-80°C upon receipt

    • For long-term storage, add 5-50% glycerol (final concentration) and store at -20°C/-80°C

    • Store working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • The protein is typically supplied in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Quality control measures:

    • Verify protein purity using SDS-PAGE (should be greater than 90%)

    • Confirm protein identity via mass spectrometry or Western blotting

    • Assess protein activity through appropriate functional assays

These guidelines ensure maximum stability and functionality of the recombinant protein for experimental applications. Proper aliquoting is essential to minimize freeze-thaw cycles that can lead to protein denaturation and loss of activity .

How can researchers design site-directed mutagenesis experiments to probe PA3311 function?

Site-directed mutagenesis represents a powerful approach to investigate the structure-function relationship of PA3311. A methodical strategy includes:

  • Target residue identification:

    • Perform sequence alignments with homologous proteins of known function

    • Use bioinformatic tools to predict functional domains and critical residues

    • Focus on highly conserved amino acids or those in predicted functional motifs

    • Consider the complete 783-amino acid sequence for comprehensive analysis

  • Mutagenesis strategy:

    • Design primers for PCR-based site-directed mutagenesis

    • Plan substitutions that alter chemical properties (e.g., charge reversal, polarity change)

    • Consider creating a panel of mutations across different domains

    • Include alanine-scanning mutagenesis for systematic functional mapping

  • Functional assays for mutant characterization:

    • Express and purify mutant proteins using the same protocol as wild-type

    • Compare biochemical properties (stability, oligomerization)

    • Assess potential DNA-binding activity if PA3311 functions as a transcriptional regulator

    • Evaluate the impact on protein-protein interactions

    • Test complementation of phenotypes in PA3311 knockout strains

  • Data analysis framework:

    • Establish clear criteria for functional impairment

    • Correlate mutations with structural features

    • Map the functional landscape of the protein through systematic analysis of multiple mutations

This comprehensive approach allows researchers to systematically probe PA3311's structure-function relationships and identify critical residues essential for its biological activity.

How might transcriptomics approaches reveal PA3311's regulatory network?

Transcriptomics provides powerful tools for deciphering PA3311's regulatory network. A comprehensive approach includes:

  • RNA-seq experimental design:

    • Compare transcriptome profiles between wild-type, ΔPA3311, and PA3311-overexpressing strains

    • Include multiple growth conditions and time points to capture context-dependent effects

    • Apply the transcriptome profile similarity analysis (TPSA) method to identify regulatory patterns

  • Data analysis framework:

    • Identify differentially expressed genes (DEGs) using established criteria (log2(fold change) ≥ 1.0, P < 0.05)

    • Perform gene set enrichment analysis to identify affected pathways

    • Look for overlap with known regulons (e.g., quorum sensing, stress response)

    • Generate co-expression networks to identify genes with similar expression patterns

  • Validation experiments:

    • Confirm key DEGs using qRT-PCR

    • Perform chromatin immunoprecipitation (ChIP) to identify direct binding targets

    • Use reporter gene assays to validate regulatory relationships

  • Data integration strategy:

    • Compare PA3311 regulon with other known regulatory networks in P. aeruginosa

    • Construct a hierarchical regulatory model incorporating PA3311

    • Identify potential master regulators controlling PA3311 expression

This methodology has successfully revealed that certain P. aeruginosa regulatory proteins control large regulons comprising thousands of genes. For example, PsdR was found to affect 504 genes (about 8.8% of total annotated genes), despite being previously thought to have a more limited role . A similar approach could reveal whether PA3311 functions as a local or global regulator.

What is known about the evolutionary conservation of PA3311 across bacterial species?

Understanding the evolutionary conservation of PA3311 provides insights into its functional importance. A methodological approach includes:

This comprehensive evolutionary analysis can provide crucial insights into PA3311's function by revealing its conservation pattern across species and identifying functionally important domains under evolutionary constraint.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.