Recombinant Pseudomonas aeruginosa Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Pseudomonas aeruginosa uppP

Function and Classification

  • Catalytic Activity: Converts UPP to UP via hydrolysis, critical for peptidoglycan synthesis and lipid carrier recycling .

  • Antibiotic Resistance: Confers resistance to bacitracin by preventing UPP sequestration, thereby sustaining peptidoglycan assembly .

  • Structural Features: A multi-pass membrane protein localized to the inner membrane, with a periplasmic pocket for substrate binding .

Recombinant Production

  • Sources: Expressed in E. coli, yeast, baculovirus, or mammalian cells .

  • Purity: High-purity formulations suitable for research applications .

  • Applications: Vaccine development, antibiotic resistance studies, and enzymatic assays .

Role in Antibiotic Resistance

Bacitracin Resistance

  • Mechanism: Bacitracin inhibits UP recycling by binding UPP. uppP counters this by regenerating UP, restoring peptidoglycan synthesis .

  • Clinical Implications: Overexpression of uppP may contribute to multidrug resistance in P. aeruginosa infections .

Comparison with Related Enzymes

EnzymeFunctionKey DifferenceSource
LpxT (P. aeruginosa)Phosphates lipid A at the 1-positionDivergent substrate specificity vs. uppP
UppSSynthesizes UPP from UDP-glucoseOpposite catalytic direction

Recombinant Production and Applications

Production Platforms

Host SystemAdvantagesChallengesSource
E. coliHigh yield, low costPotential endotoxin contamination
Mammalian CellsProper post-translational modificationsHigher production costs

Research Applications

  • Vaccine Development: Used as a component in subunit vaccines targeting P. aeruginosa .

  • Enzymatic Assays: Studied for bacitracin resistance mechanisms and lipid metabolism .

Recent Research Findings and Implications

Functional Diversity

  • Species-Specific Adaptations: P. aeruginosa uppP exhibits unique lipid A modification patterns compared to E. coli .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipment, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
uppP; PSPA7_3337; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-277
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain PA7)
Target Names
uppP
Target Protein Sequence
MEWWTAFQAFILGVVEGLTEFLPISSTGHQIIVADLIGFGGERAKAFNIIIQLAAILAVV WEFRGKIFQVVRDLPSQHQAQRFTVNLLIAFFPAVILGVLFADLIHEWLFNPITVALALV VGGVIMLWAERRQHVIRAEHVDDMTWKDALKIGCAQCLAMVPGTSRSGATIIGGLLFGLS RKAATEFSFFLAMPTMVGAAVYSGYKYRELFRPEDLPVFAVGFVTSFVFAMVAVRALLKF IGNHSYAAFAWYRIAFGLLILATWQFHLIDWSTAGDL
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Undecaprenyl-diphosphatase (UppP) in Pseudomonas aeruginosa?

Undecaprenyl-diphosphatase (UppP) catalyzes the dephosphorylation of undecaprenyl diphosphate (Und-PP) to form undecaprenyl phosphate (Und-P), which serves as an indispensable membrane anchor in bacterial cell wall biosynthesis. In P. aeruginosa, as in other bacteria, Und-P is found in finite amounts and functions as the critical lipid carrier upon which cell wall components are assembled before being transported across the cytoplasmic membrane. This process is essential for synthesizing and ferrying cell wall intermediates to the nascent cell wall . The production of Und-P represents a rate-limiting step in peptidoglycan and O-antigen synthesis, making UppP a potential target for antimicrobial development.

UppP exists alongside other phosphatases that contribute to the Und-P pool, but it plays a particularly significant role in recycling Und-PP that is released during the final stages of cell wall component attachment. This recycling process is crucial for maintaining adequate levels of the lipid carrier to support ongoing cell wall synthesis, especially during periods of rapid bacterial growth.

How does UppP relate to bacterial cell wall synthesis and antibiotic resistance?

UppP contributes to the finite pool of Und-P that is essential for both peptidoglycan and O-antigen synthesis. The bacterial cell wall has long been recognized as a critical target for antibacterial drug discovery due to its essential nature in bacteria and absence in mammalian systems . When UppP activity is compromised, the reduced availability of Und-P creates a bottleneck in cell wall synthesis, potentially affecting cell wall integrity and antibiotic susceptibility.

In P. aeruginosa, UppP's role extends to O-antigen biosynthesis, a key component of lipopolysaccharide (LPS) in the outer membrane. The O-antigen biosynthesis clusters are responsible for synthesizing specific O-antigen structures, such as the O15 and O17 OSA structures . These structures rely on the availability of Und-P as a carrier lipid, connecting UppP function directly to outer membrane composition and, consequently, to intrinsic antibiotic resistance mechanisms.

Alterations in UppP expression or activity can affect cell wall integrity, potentially influencing susceptibility to cell wall-targeting antibiotics and contributing to antibiotic resistance mechanisms. Understanding this relationship is crucial for developing strategies to combat antimicrobial resistance in P. aeruginosa infections.

What expression systems are most effective for producing recombinant P. aeruginosa UppP?

The expression of recombinant P. aeruginosa UppP benefits from strategies similar to those used for other membrane-associated enzymes involved in cell wall biosynthesis. Based on established protocols for related enzymes, E. coli expression systems using vectors with inducible promoters (such as T7) have proven effective for the heterologous expression of P. aeruginosa membrane proteins .

For optimal expression, consider the following methodology:

  • Vector selection: pET series vectors with N-terminal or C-terminal affinity tags (His6) facilitate purification while minimizing interference with enzyme activity.

  • Expression strain: E. coli BL21(DE3) or C43(DE3) strains, the latter being particularly suitable for membrane protein expression due to adaptations that reduce toxicity.

  • Induction conditions: Lower temperatures (16-25°C) and reduced IPTG concentrations (0.1-0.5 mM) often improve the yield of properly folded recombinant UppP.

  • Membrane extraction: Careful cell lysis followed by differential centrifugation to isolate membrane fractions containing the recombinant enzyme.

  • Detergent solubilization: Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at 1-2% concentration effectively solubilize membrane-associated UppP while preserving enzymatic activity.

This methodological approach enables the production of sufficient quantities of active recombinant UppP for subsequent biochemical and structural studies, similar to protocols established for UppS purification from B. subtilis, E. coli, and S. aureus .

What are the key differences between UppP and UppS in the bacterial undecaprenyl phosphate cycle?

While both UppP and UppS are critical enzymes in the undecaprenyl phosphate cycle, they catalyze distinct reactions and serve different functions:

FeatureUppP (Undecaprenyl-diphosphatase)UppS (Undecaprenyl diphosphate synthase)
Reaction catalyzedDephosphorylation of Und-PP to Und-PSynthesis of Und-PP through condensation of FPP with IPP
SubstrateUndecaprenyl diphosphate (Und-PP)Farnesyl pyrophosphate (FPP) and isopentenyl pyrophosphate (IPP)
Location in pathwayRecycling phaseBiosynthetic phase
Structural featuresIntegral membrane proteinPeripheral membrane protein
Inhibition impactReduces recycling of Und-PP to Und-PBlocks de novo synthesis of Und-PP

UppS catalyzes the synthesis of undecaprenyl diphosphate (Und-PP) through eight consecutive condensations of isopentenyl pyrophosphate (IPP) using farnesyl pyrophosphate (FPP) as the priming molecule . This represents the de novo synthesis pathway for Und-PP. In contrast, UppP recycles Und-PP back to Und-P after the lipid carrier has delivered its cargo during cell wall assembly.

Both enzymes contribute to maintaining the limited pool of Und-P available for cell wall synthesis, but they do so through different mechanisms. Inhibition of either enzyme can disrupt cell wall synthesis, making both potential targets for antimicrobial development, though with potentially different consequences for bacterial physiology.

What methodologies are most effective for assessing UppP inhibition in whole-cell versus in vitro systems?

Assessment of UppP inhibition requires complementary approaches in both whole-cell and in vitro systems to comprehensively evaluate potential inhibitors. The following methodological framework adapts strategies successfully employed for UppS inhibition studies:

In vitro enzyme assay methodology:

  • Enzyme preparation: Purify recombinant P. aeruginosa UppP using affinity chromatography with detergent micelles to maintain enzymatic activity.

  • Substrate preparation: Synthesize radiolabeled or fluorescently-tagged Und-PP substrates.

  • Reaction conditions: Optimize buffer composition (typically containing Mg²⁺), pH (around 7.5), and detergent concentration.

  • Activity measurement: Quantify dephosphorylation by measuring released phosphate using malachite green assay or by separating Und-P from Und-PP using thin-layer chromatography.

  • Inhibition assessment: Determine IC₅₀ values using a four-parameter fit with GraFit V5 or similar software, testing compounds at multiple concentrations (10 nM to 100 μM) .

Whole-cell inhibition methodology:

  • Culture preparation: Grow P. aeruginosa to mid-log phase (OD₆₀₀ ~0.35) in appropriate media.

  • MIC determination: Perform broth microdilution assays in 96-well plates with serial dilutions of potential inhibitors (final DMSO concentration ≤2%) .

  • Cell wall biosynthesis assessment: Monitor incorporation of radiolabeled precursors into peptidoglycan or O-antigen.

  • Resistance development: Plate bacteria on media containing inhibitors at 4-8× MIC to assess frequency of resistance development, similar to methods used for UppS inhibitors .

  • Membrane integrity controls: Use DiSC₃(5) fluorescence assays to distinguish specific UppP inhibition from general membrane disruption effects .

When comparing in vitro and whole-cell data, discrepancies may reflect issues with compound permeability, efflux, or off-target effects. A truly selective UppP inhibitor should demonstrate consistent structure-activity relationships between in vitro enzyme inhibition and whole-cell growth inhibition, with minimal impact on membrane potential as measured by DiSC₃(5) assays.

How can researchers accurately differentiate between UppP inhibition and off-target membrane effects when evaluating potential antimicrobial compounds?

Accurately differentiating between specific UppP inhibition and non-specific membrane effects is critical for developing selective inhibitors. Based on approaches used with UppS inhibitors, researchers should implement the following comprehensive methodology:

  • Membrane potential assessment: Utilize a DiSC₃(5) fluorescence-based assay to evaluate changes in membrane potential. Load bacterial cells with DiSC₃(5) dye and monitor fluorescence changes upon compound exposure. Compounds affecting membrane potential will show dose-dependent increases in fluorescence, while specific UppP inhibitors (like MAC-0547630 for UppS) should not perturb membrane potential .

  • Resistance mapping: Generate spontaneous resistant mutants by plating bacteria on media containing the inhibitor at 4-8× MIC. Sequence the uppP gene in resistant isolates to identify mutations. Specific UppP inhibitors will typically generate resistance mutations within the target gene, whereas membrane-active compounds often fail to generate stable resistant mutants due to their non-specific mechanism .

  • Cross-resistance analysis: Test uppP mutants resistant to one inhibitor for cross-resistance to other inhibitors. Patterns of cross-resistance can provide insights into binding sites and specificity. True UppP inhibitors with distinct binding modes may show limited cross-resistance patterns .

  • Structural correlation: Map resistance mutations onto the UppP structure (or a homology model) to identify potential binding sites. This approach was successfully used for UppS inhibitors, revealing distinct binding sites within the catalytic tunnel .

  • In vitro versus whole-cell correlation: Compare IC₅₀ values from in vitro enzyme assays with MIC values. Strong correlation suggests on-target activity, while significant discrepancies may indicate off-target effects or permeability issues.

  • Lipid bilayer disruption assays: Use artificial membrane systems to directly assess membrane-perturbing effects independent of enzymatic activity.

By implementing this multi-faceted approach, researchers can confidently differentiate between specific UppP inhibition and non-specific membrane effects, facilitating the development of selective UppP inhibitors as potential antimicrobial agents or research tools.

What genetic approaches can be employed to validate UppP as a drug target in P. aeruginosa?

Validating UppP as a drug target in P. aeruginosa requires rigorous genetic approaches to establish its essentiality and evaluate the phenotypic consequences of its inhibition. The following methodological framework provides a comprehensive strategy:

  • Conditional expression systems: Develop strains with the native uppP gene replaced by an inducible copy controlled by regulatable promoters (e.g., arabinose-inducible pBAD or tetracycline-responsive promoters). This allows for controlled depletion of UppP to confirm essentiality and observe phenotypic consequences .

  • CRISPR interference (CRISPRi): Implement CRISPRi to achieve titratable repression of uppP expression without genetic modification of the gene itself. This approach can reveal whether partial inhibition is sufficient for growth inhibition or whether complete suppression is required.

  • Resistance mapping: Following the methodology used for UppS inhibitors, isolate spontaneous resistant mutants to potential UppP inhibitors. Sequence the uppP gene and related pathways to identify resistance mechanisms and validate the target. The frequency of resistance can be determined by plating bacteria on media containing 4-8× MIC of the inhibitor .

  • Allelic replacement: Generate strains with point mutations in uppP that confer resistance to specific inhibitors. Confirming that these mutations recapitulate the resistant phenotype validates UppP as the primary target of the inhibitor.

  • Gene overexpression: Construct strains overexpressing UppP to determine whether increased target levels confer resistance to inhibitors, further validating on-target activity.

  • Synthetic lethality: Identify genetic interactions between uppP and other genes involved in cell wall biosynthesis. Synthetic lethal pairs can reveal backup pathways and potential combination therapy targets.

  • Virulence assessment: Evaluate the impact of UppP depletion on virulence in infection models. Similar to the protection studies with recombinant P. aeruginosa OMV vaccines , determine whether UppP inhibition affects bacterial survival in vivo.

This multi-faceted genetic approach provides robust validation of UppP as a drug target and offers insights into resistance mechanisms, facilitating the development of effective inhibitors with reduced likelihood of resistance emergence.

How does the coordination between UppP and UppS affect cell wall biosynthesis across different growth phases in P. aeruginosa?

The coordination between UppP and UppS activities is crucial for maintaining the limited pool of undecaprenyl phosphate (Und-P) required for cell wall biosynthesis. This coordination varies across growth phases in P. aeruginosa, with significant implications for cell wall synthesis and antibiotic susceptibility:

  • Exponential growth phase: During rapid growth, both de novo synthesis (via UppS) and recycling (via UppP) pathways operate at high capacity. UppS catalyzes the formation of Und-PP through consecutive condensations of IPP using FPP as the priming molecule . Simultaneously, UppP rapidly recycles Und-PP back to Und-P after cell wall components are transferred to the growing peptidoglycan structure. This coordinated activity ensures adequate supply of Und-P to meet the high demand for new cell wall material.

  • Early stationary phase: As growth slows, the contribution of the recycling pathway (UppP) becomes proportionally more important. The limited pool of Und-P is utilized more efficiently, with less demand for de novo synthesis by UppS. This transition reflects changes in gene expression patterns affecting both enzymes.

  • Late stationary phase: During extended stationary phase, the recycling pathway predominates, with minimal de novo synthesis. UppP activity becomes critical for maintaining cell wall integrity under stress conditions.

The precise regulation of this coordination involves multiple mechanisms:

  • Transcriptional regulation: Expression of uppP and uppS genes responds to cell wall stress and growth rate signals, likely through mechanisms similar to those regulating other cell wall biosynthesis genes.

  • Post-translational regulation: Activity of both enzymes may be modulated by protein-protein interactions and phosphorylation events dependent on growth phase.

  • Spatial organization: UppP and UppS may form part of a multi-enzyme complex at the inner membrane, facilitating efficient transfer of intermediates between enzymes.

This coordination affects susceptibility to antibiotics across growth phases. Inhibition of UppP has more severe consequences during stationary phase when recycling predominates, while UppS inhibition is more effective during rapid growth. This understanding can inform strategies for combination therapy targeting both enzymes to disrupt cell wall biosynthesis across different growth states, potentially overcoming growth phase-dependent resistance mechanisms in P. aeruginosa infections.

What structural features of UppP contribute to substrate specificity and how can this inform inhibitor design?

Understanding the structural determinants of UppP substrate specificity is crucial for rational inhibitor design. Although limited structural information is available specifically for P. aeruginosa UppP, insights can be drawn from related phosphatases and the structural studies of UppS :

  • Active site architecture: UppP contains a catalytic domain with conserved motifs typical of phosphatase enzymes. Key catalytic residues likely include aspartate and histidine residues that coordinate divalent metal ions essential for phosphatase activity. Molecular modeling suggests the active site forms a pocket capable of accommodating the phosphate group of Und-PP while interacting with the lipid chain.

  • Membrane-embedded binding tunnel: Similar to the "tunnel-shaped" conformation described for UppS , UppP likely contains a hydrophobic groove that accommodates the undecaprenyl chain of the substrate. This tunnel may be more flexible than that of UppS to allow efficient processing of the fully elongated C55 lipid chain.

  • Species-specific variations: The modest sequence identity (39-53%) observed between UppS enzymes from different bacterial species suggests similar variation may exist for UppP. These variations likely contribute to differences in substrate specificity and inhibitor sensitivity between P. aeruginosa UppP and homologs from other bacteria.

  • Conformational dynamics: UppP likely undergoes significant conformational changes during catalysis, similar to the movements observed in α-helix 3 of UppS during substrate binding . These dynamic regions represent potential targets for allosteric inhibitors that could lock the enzyme in an inactive conformation.

Based on these structural insights, rational inhibitor design strategies should consider:

  • Competitive inhibitors: Design phosphate mimetics that compete with Und-PP for the active site. These could include non-hydrolyzable phosphonate analogs of the substrate.

  • Allosteric inhibitors: Target binding sites analogous to site 3 in UppS, which interfaces with dynamic regions (like α-helix 3) involved in conformational changes . Such inhibitors could prevent the conformational changes required for catalysis.

  • Lipid chain interactions: Develop compounds that bind to the hydrophobic tunnel, potentially competing with the undecaprenyl chain of the substrate.

  • Species-selective targeting: Exploit structural differences between P. aeruginosa UppP and homologs from other bacteria to develop species-selective inhibitors, similar to the selectivity observed for UppS inhibitors .

This structure-based approach, combined with high-throughput screening strategies similar to those used for UppS, provides a framework for developing potent and selective UppP inhibitors as potential antimicrobial agents against P. aeruginosa.

What is the optimal strategy for determining enzyme kinetics parameters for recombinant P. aeruginosa UppP?

Determining accurate enzyme kinetic parameters for membrane-associated UppP requires careful consideration of experimental conditions. The following comprehensive methodology addresses the challenges specific to UppP:

  • Enzyme preparation:

    • Express recombinant P. aeruginosa UppP with a cleavable affinity tag in E. coli.

    • Extract and purify the enzyme in detergent micelles that maintain activity.

    • Verify enzyme purity by SDS-PAGE (>95% purity) and confirm identity by mass spectrometry.

  • Assay optimization:

    • Buffer composition: Test various buffers (HEPES, Tris, phosphate) at pH 7.0-8.0 containing appropriate detergent (0.01-0.05% DDM or OG) and divalent cations (Mg²⁺, Mn²⁺, Ca²⁺) at 1-10 mM.

    • Temperature: Determine optimal temperature (typically 30-37°C for P. aeruginosa enzymes).

    • Enzyme concentration: Use the minimum concentration that gives reliable activity measurements (typically 10-100 nM).

  • Substrate preparation:

    • Prepare Und-PP at various concentrations (1-100 μM) in detergent micelles.

    • For accurate Km determination, use substrate concentrations ranging from 0.1× to 10× the expected Km.

  • Activity measurement:

    • Continuous assay: Monitor phosphate release using malachite green assay or coupled enzyme assays.

    • Endpoint assay: Separate Und-P product from Und-PP substrate using TLC or HPLC methods.

  • Data analysis:

    • Determine initial reaction velocities at each substrate concentration.

    • Use non-linear regression to fit data to the Michaelis-Menten equation using software like GraFit V5 .

    • Calculate Km, Vmax, and kcat parameters.

    • For potential inhibitors, determine inhibition constants (Ki) and inhibition mechanisms (competitive, non-competitive, or uncompetitive) using appropriate plots (Lineweaver-Burk, Dixon, etc.).

  • Validation:

    • Confirm linearity of the assay with respect to time and enzyme concentration.

    • Verify reproducibility across multiple enzyme preparations.

    • Compare kinetic parameters with those reported for UppP homologs from other species.

This methodological approach, adapted from protocols successfully used for characterizing UppS from B. subtilis, E. coli, and S. aureus , enables accurate determination of UppP kinetic parameters essential for understanding enzyme function and evaluating potential inhibitors.

How can researchers effectively integrate UppP studies with investigations of O-antigen biosynthesis in P. aeruginosa?

Integrating UppP studies with O-antigen biosynthesis investigations requires a comprehensive methodological approach that bridges enzymatic, genetic, and structural analyses. The following framework establishes this connection effectively:

  • Genetic correlation studies:

    • Create conditional UppP mutants in P. aeruginosa strains with defined O-antigen serotypes (e.g., O15, O17) .

    • Quantify changes in O-antigen production under different UppP expression levels using LPS gel electrophoresis and immunoblotting with serotype-specific antibodies.

    • Map genetic interactions between uppP and genes in O-antigen biosynthesis clusters, particularly those involved in the initiation of O-antigen synthesis on Und-P.

  • Biochemical coupling assays:

    • Develop in vitro reconstitution systems containing purified UppP and initial glycosyltransferases from O-antigen biosynthesis pathways.

    • Monitor the transfer of first sugar residues (e.g., N-acetyl-glucosamine 1-phosphate in B. subtilis wall teichoic acid synthesis) onto Und-P generated by UppP activity.

    • Quantify the efficiency of coupled reactions under various conditions to identify rate-limiting steps.

  • Metabolic flux analysis:

    • Use radiolabeled precursors to track the flow of Und-P between peptidoglycan and O-antigen synthesis pathways.

    • Quantify how alterations in UppP activity affect the distribution of Und-P between these competing pathways.

    • Determine whether UppP-generated Und-P is preferentially channeled to specific biosynthetic processes.

  • Structural biology approaches:

    • Investigate potential protein-protein interactions between UppP and initial glycosyltransferases in O-antigen biosynthesis using techniques such as bacterial two-hybrid assays, co-immunoprecipitation, or crosslinking studies.

    • Examine whether UppP forms part of a multienzyme complex with O-antigen biosynthesis enzymes using blue native PAGE or size exclusion chromatography.

  • Chemical genetic strategies:

    • Develop selective UppP inhibitors and assess their impact on O-antigen production.

    • Compare effects with inhibitors targeting specific steps in O-antigen biosynthesis (e.g., WecA inhibitors).

    • Use O-antigen biosynthesis as a readout for UppP inhibition in whole-cell assays.

This integrated approach provides insights into how UppP activity influences O-antigen biosynthesis in P. aeruginosa, potentially revealing strain-specific variations related to different O-antigen structures like O15 and O17 . These methodologies establish a foundation for understanding the broader role of UppP in coordinating multiple cell envelope biosynthetic pathways that depend on the limited Und-P pool.

What approaches can be used to investigate potential synergy between UppP inhibitors and existing antibiotics against P. aeruginosa?

Investigating potential synergy between UppP inhibitors and existing antibiotics requires systematic, quantitative approaches. The following methodological framework details effective strategies:

  • Checkerboard assay methodology:

    • Prepare P. aeruginosa cultures (e.g., clinical isolates like CA-MRSA USA300) in fresh media adjusted to an OD₆₀₀ of 0.1 and diluted 1/200 .

    • Create 96-well plates containing two-dimensional serial dilutions of the UppP inhibitor and the antibiotic of interest.

    • Incubate plates at 37°C for 18 hours with shaking at 600 rpm.

    • Measure OD₆₀₀ and calculate the fractional inhibitory concentration index (FICI) to quantify synergy (FICI ≤0.5), additivity (0.5<FICI≤1), indifference (1<FICI<4), or antagonism (FICI≥4).

  • Time-kill kinetics analysis:

    • Expose P. aeruginosa cultures to the UppP inhibitor alone, antibiotic alone, or combinations at sub-MIC concentrations.

    • Sample at regular intervals (0, 2, 4, 8, 12, 24 hours) and determine viable counts by plating.

    • Plot kill curves and calculate the difference in log₁₀ CFU/mL between combination and most active single agent at each time point.

    • Synergy is typically defined as ≥2 log₁₀ reduction in viable counts with the combination compared to the most active agent alone.

  • Antibiotic classes for priority testing:

    • β-lactams (e.g., cefuroxime): Assess whether UppP inhibition enhances β-lactam activity by disrupting cell wall recycling.

    • Glycopeptides (e.g., vancomycin): Investigate whether UppP inhibition increases access to peptidoglycan targets.

    • Polymyxins (e.g., colistin): Determine if UppP inhibition affects LPS structure or membrane integrity.

    • Macrolides (e.g., azithromycin): Evaluate potential synergy through altered membrane permeability.

  • Resistance development assessment:

    • Expose P. aeruginosa to sub-inhibitory concentrations of UppP inhibitor, antibiotic, or combinations in serial passage experiments.

    • Monitor changes in MIC values over time (15-20 passages).

    • Sequence relevant genes in resistant isolates to identify resistance mechanisms.

    • Compare resistance frequencies to combinations versus single agents using methodology similar to that used for UppS inhibitors .

  • Mechanistic investigation of synergy:

    • Assess changes in cell envelope integrity using membrane permeability assays.

    • Quantify alterations in O-antigen production or peptidoglycan cross-linking.

    • Evaluate changes in antibiotic uptake or efflux in the presence of UppP inhibitors.

This methodological framework provides a comprehensive approach to identifying and characterizing synergistic interactions between UppP inhibitors and existing antibiotics, potentially revealing novel combination therapies effective against P. aeruginosa infections.

How might advances in structural biology facilitate the development of selective UppP inhibitors for P. aeruginosa?

Recent advances in structural biology offer promising approaches for developing selective UppP inhibitors. The following methodological framework outlines how these advances can be leveraged:

  • Cryo-electron microscopy (cryo-EM) applications:

    • Utilize recent advances in single-particle cryo-EM to resolve the structure of P. aeruginosa UppP in different conformational states.

    • Apply lipid nanodisc technology to study UppP in a native-like membrane environment.

    • Implement time-resolved cryo-EM to capture catalytic intermediates during the dephosphorylation reaction.

  • Computational approaches for structure-based drug design:

    • Develop homology models of P. aeruginosa UppP based on related phosphatases.

    • Employ molecular dynamics simulations to identify conformational changes during catalysis, similar to the movements observed in α-helix 3 of UppS .

    • Implement virtual screening of compound libraries against identified binding sites.

    • Utilize machine learning algorithms to predict ligand binding affinities and optimize lead compounds.

  • Fragment-based drug discovery methodology:

    • Screen fragment libraries using differential scanning fluorimetry or surface plasmon resonance.

    • Determine structures of UppP-fragment complexes using X-ray crystallography or cryo-EM.

    • Apply fragment growing, linking, or merging strategies to develop high-affinity inhibitors.

    • Validate binding modes through site-directed mutagenesis of predicted interaction residues.

  • Resistance mapping for binding site identification:

    • Apply the methodology used for UppS inhibitors to generate spontaneous resistant mutants to lead compounds .

    • Sequence uppP genes from resistant isolates to identify mutations.

    • Map resistance mutations onto structural models to define binding sites.

    • Use this information to design inhibitors with reduced resistance potential.

  • Species-selective inhibitor development:

    • Compare UppP structures from P. aeruginosa with homologs from other bacteria and human phosphatases.

    • Identify unique structural features in P. aeruginosa UppP for selective targeting.

    • Design inhibitors that exploit these differences to achieve species selectivity similar to that observed with UppS inhibitors .

This integrated structural biology approach provides a robust framework for developing selective UppP inhibitors as potential antimicrobial agents against P. aeruginosa, addressing the critical need for new treatments against this difficult-to-treat pathogen.

What opportunities exist for developing UppP-targeting vaccines or immunotherapies against P. aeruginosa infections?

Developing UppP-targeting vaccines or immunotherapies against P. aeruginosa presents innovative opportunities for infection prevention and treatment. The following methodological framework outlines promising approaches:

  • Recombinant OMV vaccine platform:

    • Adapt the outer membrane vesicle (OMV) technology used for PcrV-HitA fusion antigens to develop UppP-containing immunogens.

    • Engineer attenuated P. aeruginosa strains (similar to PA-m14) with UppP modifications that increase immunogenicity while maintaining proper folding.

    • Incorporate UppP into OMVs along with established protective antigens to create multivalent vaccines.

    • Assess immune responses using methodology similar to that used for OMV-PH vaccines, which showed 70% protection against P. aeruginosa challenge .

  • Epitope identification and selection:

    • Identify surface-exposed regions of UppP accessible to antibodies using computational predictions and experimental mapping.

    • Focus on conserved epitopes across P. aeruginosa strains to ensure broad protection.

    • Design peptide vaccines based on these epitopes, potentially conjugated to carrier proteins.

    • Evaluate epitope immunogenicity through antibody titer measurements and T-cell activation assays.

  • Antibody-dependent therapeutic strategies:

    • Develop monoclonal antibodies targeting UppP epitopes that inhibit enzyme activity or mark bacteria for immune clearance.

    • Assess antibody-dependent opsonophagocytic killing similar to assays used for OMV-PH vaccination .

    • Create antibody-antibiotic conjugates that deliver antimicrobial agents directly to P. aeruginosa cells.

    • Evaluate the therapeutic efficacy of these antibodies in acute and chronic infection models.

  • T-cell-based immunotherapy approaches:

    • Identify UppP-derived peptides that stimulate robust Th1/Th17 responses, which were effective in OMV-PH vaccination .

    • Design vaccine formulations that specifically enhance these T-cell responses through appropriate adjuvant selection.

    • Evaluate cross-protection against diverse P. aeruginosa strains.

    • Assess memory T-cell generation for long-term protection.

  • Vaccination route optimization:

    • Compare intramuscular, intranasal, and other administration routes for UppP-based vaccines.

    • Determine whether different routes affect the balance between humoral and cell-mediated immunity.

    • Optimize dosing schedules based on immune response kinetics and duration of protection.

This comprehensive immunotherapy framework builds upon the success observed with recombinant P. aeruginosa OMV vaccines , adapting these approaches to target UppP. The strategy addresses both antibody and T-cell responses, offering potential for both prophylactic vaccination and therapeutic intervention against P. aeruginosa infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.