Recombinant Pseudomonas aeruginosa Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

ParameterValue
Amino Acid Length339 residues
Molecular Weight37.3 kDa
Isoelectric Point8.21
Charge (pH 7)3.05
Hydrophobicity (Kyte-Doolittle)0.193
UniProtKB AccessionQ9HY64
UniProtKB IDARNC_PSEAE
SynonymsArnC, PmrF

Functional Role in Antimicrobial Resistance

ArnC plays a pivotal role in the development of resistance to polymyxins and other cationic antimicrobial peptides (CAPs) in P. aeruginosa and other gram-negative pathogens . As part of the arnBCADTEF-pmrE operon (also known as pmrHFIJKLME, spanning PA3552 to PA3559), it participates in a sophisticated biochemical pathway that ultimately modifies the bacterial lipopolysaccharide structure .

Mechanism of Resistance

The primary mechanism through which ArnC contributes to antimicrobial resistance involves the covalent addition of 4-amino-L-arabinose (L-Ara4N) to phosphate groups within the lipid A and core oligosaccharide components of lipopolysaccharide (LPS) . This modification process occurs through the following steps:

  1. Synthesis of UDP-L-Ara4FN (formylated precursor) in the cytoplasm

  2. ArnC-mediated transfer of L-Ara4FN from UDP to undecaprenyl phosphate (UndP)

  3. Deformylation of UndP-L-Ara4FN by ArnD

  4. Transport of L-Ara4N across the inner membrane

  5. Transfer of L-Ara4N to lipid A phosphate groups

The addition of the positively charged L-Ara4N to the negatively charged phosphate groups of lipid A reduces the net negative charge of the bacterial outer membrane. This modification directly interferes with the binding of cationic antimicrobial peptides like polymyxins, which typically interact with LPS through electrostatic interactions .

Deletion analysis has demonstrated that disruption of the arnC gene results in decreased levels of UndP-Ara4FN and consequently reduced polymyxin resistance . This confirms ArnC's essential role in the L-Ara4N modification pathway and antimicrobial resistance.

Regulation of ArnC Expression

The expression of ArnC in P. aeruginosa is tightly regulated by multiple two-component regulatory systems (TCSs) that respond to environmental signals, particularly those indicating antimicrobial peptide exposure or divalent cation depletion . These regulatory systems include:

  1. PhoPQ

  2. PmrAB

  3. ParRS

  4. CprRS

  5. ColRS

These TCSs convergently regulate polymyxin resistance by inducing arnBCADTEF-pmrE operon transcription. The sensor kinase components (e.g., PmrB) activate their cognate response regulators (e.g., PmrA) through phosphotransfer relays, which then stimulate transcription of the arn operon .

Interestingly, mutations in these regulatory systems, particularly in PmrB, can lead to constitutive activation and high-level polymyxin resistance . Clinical isolates of P. aeruginosa from cystic fibrosis patients chronically treated with colistin (polymyxin E) have been found to contain gain-of-function pmrB alleles that confer polymyxin resistance with MICs exceeding 512 mg/liter .

Regulatory Mechanisms Affecting ArnC Expression

Regulatory SystemActivation ConditionEffect on ArnC Expression
PhoPQMg²⁺ limitation, CAP exposureIncreased
PmrABMg²⁺ limitation, CAP exposure, gain-of-function mutationsIncreased
ParRSAntimicrobial peptide exposureIncreased
CprRSAntimicrobial peptide exposureIncreased
ColRSEnvironmental stressIncreased

Recombinant ArnC Production and Applications

The production of recombinant ArnC has significantly facilitated research into its structure, function, and potential as a therapeutic target. Recombinant full-length P. aeruginosa ArnC (UniProt ID: A6V1P1) can be expressed in E. coli expression systems with an N-terminal His-tag for purification purposes .

Role of ArnC in the Antimicrobial Resistance Pathway

The arnBCADTEF-pmrE operon encodes seven proteins that collectively function in the L-Ara4N modification pathway . Within this pathway, ArnC performs a specific and essential function: the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate .

Research has demonstrated that while L-Ara4N modification of lipid A is necessary for polymyxin resistance in P. aeruginosa, it is not always sufficient . Additional factors regulated by the CprRS two-component system are also required for full resistance. Disruption of the cprRS locus results in partial loss of PhoPQ-mediated polymyxin resistance without affecting L-Ara4N modification of lipid A .

Furthermore, the polymyxin resistance phenotype can be unstable in some clinical isolates. Repeated passage without antibiotic selection pressure can result in loss of resistance, suggesting the occurrence of secondary suppressors at relatively high frequency . This phenotypic instability highlights the complex nature of antimicrobial resistance mechanisms in P. aeruginosa.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnC; PSPA7_1592; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain PA7)
Target Names
arnC
Target Protein Sequence
MKPYPIDLVSVVIPVYNEEASLPELLRRTEAACRSLGRAFEIVLVDDGSRDRSAELLQAA AERDGCAVVAVILNRNYGQHAAILAGFEQSRGDLVITLDADLQNPPEEIPRLVERAAQGY DVVGSIRDNRRDSAWRRWPSRLVNLAVQRSTGVAMHDYGCMLRAYRRSIVEAMLACRERS TFIPILANGFARHTCEIRVAHAERAHGESKYSAMRLLNLMFDLVTCMTTTPLRLLSLVGG GMALAGFLFALFLLVLRLAFGAAWAGNGLFVLFAVLFMFSGVQLLGMGLLGEYLGRMYSD VRARPRFFIERVVRAAPSALPSALQRAGFTSSSSEPSTP
Uniprot No.

Target Background

Function
Catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. The modified arabinose is attached to lipid A and is essential for resistance to polymyxin and cationic antimicrobial peptides.
Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) in Pseudomonas aeruginosa?

ArnC catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose (Ara4FN) from UDP to undecaprenyl phosphate. This modified arabinose is subsequently attached to lipid A in the bacterial outer membrane, a critical modification for resistance to polymyxin antibiotics and cationic antimicrobial peptides . The enzyme functions within the arn operon-encoded pathway that enables P. aeruginosa to modify its lipopolysaccharide structure. This modification reduces the net negative charge of the bacterial surface, diminishing the binding affinity of positively charged antimicrobial compounds. The arnC-mediated modification represents one of several mechanisms contributing to P. aeruginosa's intrinsic resistance to various antibiotics, making it a significant enzyme in the context of bacterial pathogenesis .

How does the arnC gene contribute to antibiotic resistance in P. aeruginosa?

The arnC gene plays a crucial role in P. aeruginosa's resistance to polymyxins and other cationic antimicrobial peptides through several mechanisms:

  • Lipid A Modification: By facilitating the addition of 4-deoxy-4-formamido-L-arabinose to lipid A, arnC reduces the negative charge of the bacterial outer membrane, decreasing the electrostatic attraction between positively charged antimicrobial peptides and the bacterial surface .

  • Inducible Expression: Expression of arnC increases in response to environmental conditions such as low magnesium or the presence of antimicrobial peptides, allowing adaptive resistance .

  • Cross-Resistance Development: The modifications mediated by arnC can confer cross-resistance to different classes of cationic antimicrobial compounds, expanding the protection scope.

  • Structural Barrier Enhancement: The modified lipid A creates a more robust permeability barrier against hydrophobic antimicrobial agents.

Research demonstrates that mutations or deletions in the arnC gene significantly reduce P. aeruginosa's resistance to polymyxin antibiotics, highlighting its importance in the antibiotic resistance profile of this opportunistic pathogen .

What is the structure of the arnC protein in P. aeruginosa?

While high-resolution crystal structures of P. aeruginosa arnC have not been fully characterized, bioinformatic analyses and comparative studies with homologous proteins reveal several key structural features:

  • Membrane Association: ArnC is a membrane-associated glycosyltransferase that contains hydrophobic domains allowing interaction with the inner membrane where its undecaprenyl phosphate substrate is localized .

  • Glycosyltransferase Fold: The enzyme likely adopts the characteristic GT-B fold common to many glycosyltransferases, consisting of two Rossmann-like domains with a catalytic site located in the cleft between them.

  • Conserved Motifs: Sequence analyses have identified motifs common to glycosyltransferase family 4 (GT4) enzymes, including the DXD motif involved in coordination of divalent cations essential for catalysis.

  • Substrate Binding Regions: Distinct regions within the protein are specialized for binding the nucleotide-sugar donor (UDP-Ara4FN) and the lipid acceptor (undecaprenyl phosphate) .

  • Catalytic Residues: Conservative substitution studies have identified key residues involved in substrate recognition and catalysis, though their precise arrangement awaits structural determination.

The complete amino acid sequence of the protein reveals a molecular weight of approximately 40-45 kDa, typical for members of this enzyme family.

What methodologies are most effective for expressing and purifying recombinant P. aeruginosa arnC protein for structural studies?

Effective expression and purification of recombinant P. aeruginosa arnC presents several challenges due to its membrane association. Optimal methodologies include:

Expression Systems:

  • E. coli Expression: The C41(DE3) or C43(DE3) strains, derived from BL21(DE3), are recommended for arnC expression as they are engineered for membrane protein production . A pET vector system with a T7 promoter allows controlled induction with IPTG.

  • Alternative Hosts: Yeast (Pichia pastoris) or baculovirus-infected insect cells may provide better folding and post-translational modifications for difficult-to-express proteins.

Optimization Parameters:

  • Temperature: Lower expression temperatures (16-20°C) improve protein folding and solubility of membrane proteins.

  • Induction: Mild induction conditions (0.1-0.5 mM IPTG) at higher cell densities (OD₆₀₀ = 0.8-1.0) typically yield better results.

  • Fusion Tags: Addition of solubility-enhancing tags such as MBP (maltose-binding protein) or SUMO can improve protein yield.

Purification Protocol:

  • Membrane Extraction: Careful solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) is critical.

  • Affinity Chromatography: His-tag purification using Ni-NTA resin as an initial purification step.

  • Size Exclusion Chromatography: For further purification and assessment of protein homogeneity.

Quality Assessment:

  • Circular Dichroism: To assess secondary structure integrity.

  • Dynamic Light Scattering: To evaluate homogeneity and aggregation state.

  • Activity Assays: To confirm functional integrity of the purified protein.

How do mutations in the arnC gene affect the virulence and antibiotic resistance profiles of P. aeruginosa?

Mutations in the arnC gene produce multifaceted effects on P. aeruginosa's virulence and antibiotic resistance profiles:

Antibiotic Resistance Alterations:

  • Increased Susceptibility: ArnC mutants show significantly decreased MICs for polymyxin B, colistin, and various antimicrobial peptides due to impaired lipid A modification .

  • Collateral Sensitivity: Some arnC mutations create collateral sensitivity to antibiotics that are normally ineffective against P. aeruginosa.

  • Resistance Stability: Loss of arnC function can destabilize adaptive resistance mechanisms, preventing development of high-level resistance to polymyxins.

Virulence Impacts:

  • Attenuated Pathogenicity: ArnC mutants often show reduced virulence in various infection models due to increased susceptibility to host antimicrobial peptides.

  • Altered Host Immune Recognition: Modified LPS structure in arnC mutants changes pattern recognition receptor activation, potentially altering inflammatory responses.

  • Biofilm Formation: Mutations in arnC can affect biofilm development and structure, further influencing virulence potential.

Compensatory Mechanisms:

  • Upregulation of Alternative Pathways: ArnC-deficient strains may compensate by overexpressing other resistance mechanisms.

  • LPS Structural Adjustments: Alternative modifications to LPS may occur to maintain membrane integrity.

  • Fitness Costs: Mutations often carry fitness costs, affecting growth rates and competitive ability in the absence of selective pressure.

These effects demonstrate the complex role of arnC in P. aeruginosa pathogenesis beyond simple antibiotic resistance.

What are the challenges in developing inhibitors targeting the arnC enzyme in P. aeruginosa?

Developing effective inhibitors targeting arnC presents numerous challenges:

Structural Challenges:

  • Membrane Association: ArnC's association with the bacterial inner membrane complicates structural determination and inhibitor design .

  • Limited Structural Data: Absence of high-resolution structures hinders structure-based drug design.

  • Conformational Dynamics: Like many transferases, arnC likely undergoes significant conformational changes during catalysis.

Biochemical Challenges:

  • Substrate Complexity: The natural substrates (UDP-Ara4FN and undecaprenyl phosphate) are complex molecules difficult to synthesize for high-throughput screening.

  • Assay Development: Creating robust assays to measure arnC activity in a high-throughput format is technically challenging.

  • Specificity Requirements: Inhibitors must be specific to bacterial arnC without affecting human glycosyltransferases.

Pharmacological Challenges:

  • Membrane Penetration: Inhibitors must cross both outer and inner membranes of P. aeruginosa, which has notoriously low permeability.

  • Efflux Systems: P. aeruginosa possesses numerous efflux pumps that can actively expel inhibitors .

  • Combination Therapy Requirement: Single-target inhibition may be insufficient due to redundant resistance mechanisms.

Resistance Development:

  • Target Modification: Mutations in arnC could emerge that maintain function while reducing inhibitor binding.

  • Pathway Redundancy: P. aeruginosa may activate alternative lipid A modification systems.

  • Fitness Restoration: Compensatory mutations could restore fitness in arnC-inhibited bacteria.

What expression systems are optimal for producing active recombinant P. aeruginosa arnC protein?

Selection of optimal expression systems for arnC requires consideration of several factors:

Bacterial Expression Systems:

SystemAdvantagesDisadvantagesBest For
E. coli BL21(DE3)High yield, simple protocolsPotential inclusion bodiesInitial expression trials
E. coli C41/C43(DE3)Better for toxic/membrane proteinsLower yields than BL21Membrane proteins like arnC
E. coli Lemo21(DE3)Tunable expression levelsAdditional antibiotic requirementsFine-tuning expression
E. coli SHuffleEnhanced disulfide formationGrowth limitationsProteins requiring disulfide bonds

Vector Selection:

  • pET System: T7 promoter-based vectors allowing controlled induction with IPTG .

  • pBAD System: Arabinose-inducible promoter providing more tunable expression for potentially toxic proteins.

  • pCold Vectors: Cold-shock promoters that may improve folding at low temperatures.

Fusion Tags:

  • Affinity Tags: His6 or Strep-tag for purification purposes.

  • Solubility Enhancers: MBP or SUMO tags significantly improve membrane protein solubility.

  • Cleavage Sites: TEV or PreScission protease sites for tag removal after purification.

Expression Conditions:

  • Temperature: Lower temperatures (16-20°C) often improve folding of membrane proteins.

  • Induction Strategy: Gradual induction using lower IPTG concentrations (0.1-0.5 mM).

  • Media Formulation: Specialized media such as Terrific Broth with glycerol supplementation enhances membrane protein expression.

Alternative Systems:

  • Yeast Systems: Pichia pastoris for eukaryotic expression with better folding machinery.

  • Cell-Free Systems: Allow addition of detergents or lipids during synthesis to stabilize membrane proteins.

The most successful approach typically involves screening multiple expression constructs in parallel with varying tags and expression conditions to identify optimal parameters for arnC production.

How can the enzymatic activity of arnC be accurately measured in vitro?

Accurate measurement of arnC enzymatic activity requires carefully designed assays that detect the transfer of 4-deoxy-4-formamido-L-arabinose to undecaprenyl phosphate:

Substrate Preparation:

  • UDP-4-deoxy-4-formamido-L-arabinose: Can be enzymatically synthesized using the ArnA and ArnB enzymes or through chemical synthesis.

  • Undecaprenyl Phosphate: Commercial sources or extraction from bacterial membranes.

  • Labeled Substrates: Radiolabeled or fluorescently labeled substrates enhance detection sensitivity.

Direct Activity Assays:

  • Radioisotope-Based Assay:

    • Incubate purified arnC with [¹⁴C]-labeled UDP-Ara4FN and undecaprenyl phosphate

    • Extract lipid products using organic solvents

    • Quantify radioactivity in the lipid fraction by scintillation counting

  • LC-MS/MS-Based Assay:

    • React arnC with substrates under optimized conditions

    • Extract reaction products

    • Analyze by liquid chromatography-tandem mass spectrometry to detect and quantify undecaprenyl phosphate-Ara4FN formation

  • Coupled Enzyme Assay:

    • Measure UDP release during the transferase reaction

    • Couple to UDP-glucose pyrophosphorylase and detection of glucose-1-phosphate formation

Reaction Condition Optimization:

  • Buffer Composition: Test various buffers (HEPES, Tris, phosphate) at pH range 7.0-8.0

  • Divalent Cations: Evaluate requirements for Mg²⁺, Mn²⁺ at 1-10 mM

  • Detergents: Optimize type (DDM, CHAPS) and concentration (0.01-0.1%)

  • Temperature and Time: Typically 30°C for 15-60 minutes

These methodologies provide complementary approaches to accurately characterize arnC activity under different experimental conditions.

What controls should be included when studying the effects of arnC knockouts in P. aeruginosa?

Robust experimental design for arnC knockout studies requires comprehensive controls:

Genetic Controls:

  • Wild-Type Strain: The parental strain without any genetic manipulation.

  • Complemented Mutant: The arnC knockout strain with the gene reintroduced on a plasmid or at a neutral chromosomal site.

  • Vector Control: If using plasmid-based complementation, include the knockout strain with empty vector.

  • Polar Effect Control: Analysis of expression of genes downstream of arnC to rule out polar effects.

Phenotypic Validation Controls:

  • Gene Expression Verification: RT-PCR or RNA-seq to confirm absence of arnC transcript in the knockout.

  • Protein Expression Verification: Western blot to confirm absence of ArnC protein if antibodies are available.

  • Lipid A Analysis: Mass spectrometry analysis of lipid A to confirm the expected changes in Ara4FN modifications .

Experimental Controls for Specific Assays:

  • Antibiotic Susceptibility Testing:

    • Include reference strains with known MIC values

    • Test multiple antimicrobial peptides and polymyxins

    • Include non-cationic antibiotics as specificity controls

  • Membrane Integrity Assays:

    • Include positive controls (membrane-permeabilizing agents)

    • Use multiple dyes that assess different aspects of membrane function

  • In Vivo Infection Models:

    • Include sham-infected controls

    • Use both immunocompetent and immunocompromised models where appropriate

    • Monitor bacterial burden at multiple time points

Environmental Condition Controls:

  • Stress Conditions: Test phenotypes under both standard and stress conditions (low Mg²⁺, antimicrobial peptide exposure) where arnC would normally be induced .

  • Growth Phase: Assess phenotypes at different growth phases as gene expression may vary.

  • Media Composition: Compare phenotypes in different media types to account for nutrient-dependent effects.

These comprehensive controls ensure that observed phenotypes can be specifically attributed to arnC function rather than to experimental artifacts or secondary effects.

How can conflicting data regarding the role of arnC in antibiotic resistance be reconciled?

Conflicting data regarding arnC's role in antibiotic resistance may arise from multiple sources and can be reconciled through systematic approaches:

Sources of Discrepancies:

  • Strain Variability: Different P. aeruginosa strains may show varying dependence on arnC for resistance .

  • Environmental Conditions: Growth conditions significantly impact the expression and functional importance of arnC.

  • Genetic Background: The effect of arnC deletion may depend on the presence of other resistance mechanisms.

  • Methodological Differences: Variations in antimicrobial susceptibility testing methods can produce apparently conflicting results.

Reconciliation Strategies:

  • Meta-Analysis Approach:

    • Systematically compile available data on arnC and resistance phenotypes

    • Stratify studies by strain background and experimental methods

    • Apply statistical meta-analysis techniques to identify consistent patterns

    • Identify experimental variables that correlate with divergent results

  • Standardized Comparative Studies:

    • Perform parallel experiments with multiple strains under identical conditions

    • Use standardized methodologies for antimicrobial susceptibility testing

    • Create isogenic mutants in different strain backgrounds

    • Implement blinded analysis to reduce experimental bias

  • Mechanistic Investigation:

    • Conduct detailed biochemical analyses of lipid A modifications across strains

    • Quantify arnC expression levels under different conditions

    • Investigate potential compensatory mechanisms that may mask arnC effects

    • Examine regulatory elements controlling arnC expression in different genetic backgrounds

These approaches allow researchers to develop a more nuanced understanding of arnC's role in antibiotic resistance that accounts for strain-specific and condition-dependent effects.

What bioinformatic tools are most useful for analyzing the conservation of arnC across Pseudomonas species?

Comprehensive analysis of arnC conservation across Pseudomonas species requires a systematic bioinformatic approach:

Sequence Analysis Tools:

  • BLAST and HMMER: For initial identification of arnC homologs in Pseudomonas genomes.

  • Multiple Sequence Alignment Tools: Clustal Omega, MUSCLE, or T-Coffee for aligning identified sequences.

  • Phylogenetic Analysis: RAxML, MrBayes, or IQ-TREE for constructing evolutionary trees to visualize relationships between arnC variants.

  • Visualization Tools: Jalview or AliView for visualizing and analyzing sequence alignments.

Structural Analysis Tools:

  • Homology Modeling: SWISS-MODEL, Phyre2, or I-TASSER for predicting structural models of arnC variants.

  • Structural Comparison: PyMOL or UCSF Chimera for comparing predicted structures.

  • ConSurf Server: For mapping sequence conservation onto structural models.

Genomic Context Analysis:

  • Genome Browsers: Artemis or IGV for visualizing the genomic context of arnC genes.

  • Operon Prediction Tools: OperonDB or DOOR for identifying operonic structures.

  • Synteny Analysis: SynMap or Mauve for comparing gene order conservation across species.

Evolutionary Analysis:

  • Selection Analysis: PAML or HyPhy for detecting signatures of selection on arnC genes.

  • Coevolution Analysis: CAPS or EVcouplings for identifying coevolving residues.

  • Ancestral State Reconstruction: FastML or MEGA for inferring ancestral sequences.

The conservation of arnC among Pseudomonas species follows taxonomic-based evolution, with some species showing high conservation while others lack clear homologs . This pattern provides insights into the evolutionary history of LPS modification pathways and their importance in different ecological niches.

How should researchers interpret changes in arnC expression in response to different environmental stressors?

Interpreting changes in arnC expression requires careful consideration of multiple factors:

Contextual Interpretation Framework:

  • Baseline Comparison: Always compare stress-induced expression to appropriate baseline conditions.

  • Temporal Dynamics: Examine expression changes over time, not just endpoint measurements.

  • Strain Background: Interpret expression changes in the context of the specific P. aeruginosa strain.

Biological Context Considerations:

  • Regulatory Networks:

    • Integrate arnC expression data with known regulatory pathways (PhoPQ, PmrAB)

    • Consider co-regulation with other resistance genes

    • Examine expression of transcriptional regulators alongside arnC

  • Functional Consequences:

    • Correlate expression changes with phenotypic outcomes (antimicrobial resistance)

    • Measure Lipid A modifications to confirm functional translation

    • Assess whether expression changes exceed thresholds needed for biological effects

Analytical Approaches:

  • Multifactorial Analysis:

    • Use factorial experimental designs to identify interactions between stressors

    • Apply appropriate statistical methods to quantify main effects and interactions

    • Develop models relating environmental conditions to expression levels

  • Comparative Transcriptomics:

    • Compare arnC expression with global transcriptional profiles

    • Use clustering to identify genes with similar expression patterns

    • Apply gene set enrichment analysis to identify coordinated regulation

  • Systems Biology Integration:

    • Incorporate expression data into mathematical models of resistance mechanisms

    • Use network analysis to identify key factors influencing arnC expression

By employing these approaches, researchers can develop a comprehensive understanding of how arnC regulation contributes to adaptive responses in P. aeruginosa across diverse environmental conditions .

What novel therapeutic approaches could target the arnC pathway to overcome antimicrobial resistance?

Targeting the arnC pathway offers several promising therapeutic approaches to combat antimicrobial resistance in P. aeruginosa:

  • Direct Enzyme Inhibition: Development of small molecule inhibitors that specifically target the catalytic site of arnC, preventing the transfer of Ara4FN to undecaprenyl phosphate .

  • Substrate Mimetics: Design of substrate analogs that compete with natural substrates but cannot be processed by arnC, effectively blocking the pathway.

  • Allosteric Modulators: Identification of compounds that bind to allosteric sites on arnC, inducing conformational changes that render the enzyme inactive.

  • Adjuvant Therapy: Development of arnC inhibitors as adjuvants to be co-administered with existing antibiotics, restoring their efficacy against resistant strains .

  • Anti-resistance Vaccines: Utilization of recombinant arnC protein as a component in vaccines designed to target antibiotic-resistant P. aeruginosa strains .

  • Antisense Strategies: Design of antisense oligonucleotides or CRISPR-based approaches to downregulate arnC expression at the genetic level.

The most promising approaches will likely combine arnC inhibition with other therapeutic strategies to overcome the redundancy in resistance mechanisms characteristic of P. aeruginosa infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.