Recombinant Pseudomonas aeruginosa UPF0060 membrane protein PA14_21660 (PA14_21660)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudomonas aeruginosa UPF0060 Membrane Protein PA14_21660

PA14_21660 is a recombinant UPF0060 family membrane protein encoded by the PA14_21660 gene in Pseudomonas aeruginosa PA14, a highly virulent clinical isolate. UPF0060 proteins are part of the uncharacterized protein families (UPFs) with conserved membrane-associated domains, though their precise biological roles remain unclear. PA14_21660 is distinct from other PA14-specific virulence factors (e.g., exoU, rhlR) but shares structural and functional similarities with UPF0060 homologs in other Pseudomonas strains, such as PA3275 in PAO1 (UniProt: Q9HYW6) .

2.1. Protein Structure

UPF0060 proteins are membrane-associated, with potential transmembrane domains and hydrophobic regions. While PA14_21660’s exact topology is uncharacterized, studies on related UPF0060 members suggest:

  • Membrane localization: Likely embedded in the bacterial outer membrane or periplasmic space.

  • Domain organization: May include conserved motifs for protein-protein interactions or substrate binding.

3.1. Strain-Specific Virulence and Genomic Context

PA14 exhibits enhanced virulence compared to PAO1, partly due to pathogenicity islands and regulatory mutations (e.g., ladS) . While PA14_21660 is not a known virulence factor, its presence in PA14 may reflect strain-specific adaptations:

  • Genomic conservation: UPF0060 genes are conserved across Pseudomonas strains but lack functional annotation .

  • Hypothetical roles: Could modulate membrane permeability or interact with efflux pumps, influencing antibiotic resistance.

3.2. Recombinant Production and Applications

Recombinant PA14_21660 would follow protocols similar to other Pseudomonas membrane proteins:

  • Expression: Use E. coli systems with T7 promoters and affinity tags (e.g., His-tag) for purification .

  • Purification: SDS-PAGE validation and solubility optimization, as demonstrated for OmpF and T7-tagged proteins .

  • Applications: Structural studies via circular dichroism (CD) or cryo-EM, or use as a vaccine antigen in outer-membrane vesicle (OMV) formulations .

MethodApplication to PA14_21660Example from Literature
Recombinant expressionE. coli with pET30acer vectors OmpF-His tag production
Structural analysisCD spectroscopy for secondary structure Membrane protein CD reference sets
Vaccine developmentOMV-based delivery systems PH antigen in PA-m14 OMVs

Critical Gaps and Future Directions

PA14_21660 remains understudied, with no published functional or structural data. Key priorities include:

  • Functional assays: Testing for porin activity, efflux pump interactions, or biofilm modulation.

  • Comparative genomics: Aligning PA14_21660 with UPF0060 homologs to identify conserved motifs.

  • High-throughput screening: Leveraging CRISPR-Cas9 or transposon mutagenesis to assess virulence contributions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
PA14_21660; UPF0060 membrane protein PA14_21660
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain UCBPP-PA14)
Target Names
PA14_21660
Target Protein Sequence
MINYLWFVLAAFCEIAGCYAFYLWLRLGKSALWVLPGLLSLTLFALLLTRVEASYAGRAY AAYGGIYVAASLFWLAFVERSRPLWSDWLGVALCVVGASVVLFGPRLSQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.