Recombinant Pseudomonas aeruginosa UPF0060 membrane protein PA3275 (PA3275)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
PA3275; UPF0060 membrane protein PA3275
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
PA3275
Target Protein Sequence
MINYFWFVLAAFCEIAGCYAFYLWLRLGKSALWVLPGLLSLTLFALLLTRVEASYAGRAY AAYGGIYVAASLFWLAFVERSRPLWSDWLGVALCVVGASVVLFGPRLSQ
Uniprot No.

Target Background

Database Links

KEGG: pae:PA3275

STRING: 208964.PA3275

Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is PA3275 and what organism does it come from?

PA3275 is a small membrane protein (109 amino acids) belonging to the UPF0060 family found in Pseudomonas aeruginosa, specifically characterized in the P. aeruginosa PAO1 strain (ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101) . The "UPF" designation (Uncharacterized Protein Family) indicates that while this protein has been identified and sequenced, its specific biological function remains largely unknown. Its localization in cellular membranes suggests potential roles in processes such as transport, signaling, or maintaining membrane integrity.

What is known about the structure of PA3275?

Current structural information for PA3275 derives primarily from computational modeling rather than experimental determination methods. An AlphaFold-predicted structure is available with the identifier AF-Q9HYW6-F1, which has a global pLDDT (predicted Local Distance Difference Test) score of 88.89, indicating a confident prediction . This computational model, released in AlphaFold DB on December 9, 2021 and updated on September 30, 2022, provides insights into the potential three-dimensional arrangement of PA3275. The protein likely contains multiple transmembrane segments, consistent with its classification as a membrane protein.

What are the basic biochemical properties of PA3275?

PA3275 is characterized by the following properties:

PropertyValue
Length109 amino acids
Molecular weight12.1 kDa
Protein familyUPF0060
Primary sequenceMINYFWFVLAAFCEIAGCYAFYLWLRLGKSALWVLPGLLSLTLFALLLTRVEASYAGRAYAAYGGIYVAASLFWLAFVERSRPLWSDWLGVALCVVGASVVLFGPRLSQ
UniProt identifierQ9HYW6

The sequence displays a high proportion of hydrophobic amino acids, consistent with its predicted membrane localization. The presence of multiple hydrophobic stretches suggests several potential transmembrane domains.

What expression systems are most suitable for recombinant production of PA3275?

When selecting an expression system for PA3275, researchers should consider several options based on their specific research goals:

Expression SystemAdvantagesDisadvantagesRecommendations
E. coli (specialized strains)Cost-effective, rapid growth, established protocolsMay not properly fold membrane proteinsUse C41(DE3) or Lemo21(DE3) strains; express at low temperatures (16-20°C)
P. aeruginosaNative membrane environment, proper folding likelyPathogenicity concerns, slower growthIdeal for functional studies; consider using controlled expression systems
Cell-free systemsAvoids toxicity, direct access to reaction conditionsLower yields, requires membrane mimeticsAdd nanodiscs or liposomes to stabilize the membrane protein
Yeast (P. pastoris)Eukaryotic folding machinery, high-density cultureDifferent membrane compositionConsider for stable isotope labeling studies

For initial expression trials, specialized E. coli strains with low-level induction are recommended, followed by homologous expression in P. aeruginosa for functional studies if needed .

What purification strategies are most effective for membrane proteins like PA3275?

Purifying membrane proteins like PA3275 requires specialized approaches:

  • Membrane extraction and solubilization:

    • Isolate membrane fraction via ultracentrifugation

    • Solubilize using mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl maltose neopentyl glycol)

    • Consider detergent screening to identify optimal solubilization conditions

  • Chromatographic purification:

    • Affinity chromatography (using His-tag or other fusion tags)

    • Size exclusion chromatography to remove aggregates and assess oligomeric state

    • Maintain detergent above CMC (critical micelle concentration) in all buffers

  • Quality assessment:

    • SDS-PAGE for purity evaluation

    • Western blotting for identity confirmation

    • SEC-MALS for homogeneity and oligomeric state determination

Given PA3275's small size (12.1 kDa) , a two-step purification approach using IMAC followed by size exclusion chromatography is typically sufficient to achieve high purity.

How can I design knockout or conditional expression experiments for PA3275?

To investigate the biological significance of PA3275, consider these methodological approaches:

  • Complete knockout strategies:

    • Homologous recombination replacing PA3275 with an antibiotic resistance cassette

    • CRISPR-Cas9 genome editing to create precise deletions

    • Single crossover disruption as described in patent literature

  • Conditional expression approaches (particularly important if PA3275 proves essential):

    • Promoter replacement strategy: Replace the native promoter with an inducible one such as the arabinose-inducible araBAD promoter

    • Degron tagging for controlled protein degradation

    • CRISPRi (CRISPR interference) for transcriptional repression

Always include appropriate controls and validate the genetic modifications by PCR, sequencing, and expression analysis .

What computational approaches can predict PA3275's cellular function?

Multiple computational strategies can help generate hypotheses about PA3275's function:

  • Sequence-based analyses:

    • Profile-based searches (PSI-BLAST, HHpred) to identify distant homologs

    • Motif/domain searches using PROSITE, Pfam, and InterPro

    • Transmembrane topology prediction with TMHMM or Phobius

  • Structure-based analyses:

    • Binding site prediction on the AlphaFold model

    • Structural alignment with functionally characterized proteins

    • Molecular docking to predict potential ligand interactions

  • Genomic context analyses:

    • Gene neighborhood examination (functionally related genes often cluster)

    • Phylogenetic profiling to identify co-evolving genes

    • Co-expression pattern analysis

  • Integrated prediction approaches:

    • Meta-servers that combine multiple prediction methodologies

    • Machine learning algorithms trained on multiple features

    • Consensus scoring across different prediction methods

The confidence in functional predictions increases when multiple independent methods converge on similar functional hypotheses.

How can I investigate protein-protein interactions involving PA3275?

Identifying interaction partners can provide crucial insights into PA3275's function. Based on network analysis methodologies , consider these approaches:

  • Experimental interaction mapping:

    • Bacterial two-hybrid or split-protein complementation assays

    • Co-immunoprecipitation with tagged PA3275

    • Crosslinking mass spectrometry to capture transient interactions

    • Proximity-dependent biotin labeling (BioID)

  • Network analysis methodology:

    • Generate protein-protein interaction networks using databases like STRING

    • Apply node degree calculations to assess connectivity

    • Use ranking methods like cytoHubba to identify key network positions

    • Perform cluster analysis to identify functional modules

  • Data filtering and prioritization:

    • Apply dual filter criteria (log fold change ≥2 and FDR ≤0.01)

    • Prioritize interactions validated by multiple methods

    • Consider evolutionary conservation of interactions

  • Functional validation:

    • Confirm direct interactions via in vitro binding assays

    • Assess functional relevance through genetic epistasis analysis

    • Investigate co-localization using fluorescence microscopy

This systematic approach can help position PA3275 within cellular networks and generate testable hypotheses about its function.

What approaches can determine if PA3275 is essential for P. aeruginosa viability?

Determining whether PA3275 is essential requires careful experimental design to distinguish true essentiality from growth defects:

  • Direct evidence approaches:

    • Attempted gene deletion using multiple independent methods

    • Transposon insertion sequencing (Tn-seq) to identify regions that cannot tolerate disruption

    • Depletion studies using degradation tags or repressible promoters

  • Complementation testing:

    • Introduction of an extra copy before attempting chromosomal deletion

    • Heterologous expression of orthologs from other species

    • Domain complementation to identify essential regions

  • Statistical validation:

    • Apply Bayesian statistical modeling as mentioned in patent literature to increase confidence in essentiality predictions

    • Compare results across multiple experimental approaches

    • Control for growth conditions that might affect apparent essentiality

  • Supporting contextual evidence:

    • Evolutionary conservation analysis (essential genes are typically more conserved)

    • Examination of genomic proximity to other essential genes

    • Chemical genetic interactions with known essential pathways

The patent literature suggests methodologies specifically developed for identifying essential genes in P. aeruginosa that could be applied to PA3275 .

How should I analyze structural data from computational models of PA3275?

When interpreting computational models like the AlphaFold prediction for PA3275 , consider:

  • Model quality assessment:

    • Evaluate the global pLDDT score (88.89 for PA3275, indicating confident prediction)

    • Examine per-residue confidence scores to identify well-predicted regions

    • Consider predicted aligned error (PAE) if available for domain arrangement reliability

  • Structural feature analysis:

    • Identify transmembrane helices and membrane orientation

    • Map conserved residues onto the structure to identify potential functional sites

    • Analyze surface properties and potential binding pockets

  • Validation approaches:

    • Compare predictions with multiple tools (not just AlphaFold)

    • Validate transmembrane predictions with specialized algorithms

    • Correlate structural features with experimental data when available

  • Limitations awareness:

    • Computational models may not capture conformational dynamics

    • Interactions with lipids or other proteins are typically not represented

    • Alternative conformational states may exist in vivo

This analytical framework helps extract maximum value from computational models while acknowledging their limitations.

What statistical approaches are appropriate for analyzing PA3275 experimental data?

Selecting appropriate statistical methods depends on your experimental design and data type:

Experiment TypeData CharacteristicsRecommended Statistical Approaches
Differential expressionContinuous, potentially non-normalDESeq2 or EdgeR with FDR correction
Growth phenotypesContinuous time-series dataMixed-effects models, area under curve analysis
Mutagenesis studiesCategorical outcomesChi-square, Fisher's exact test
Network analysesConnectivity measuresGraph theory metrics, enrichment analysis
Multiple endpoint comparisonVarious measurementsMultivariate analysis, principal component analysis

Key statistical considerations include:

  • Apply appropriate multiple testing correction (e.g., FDR ≤0.01)

  • Report effect sizes alongside p-values (e.g., log fold change ≥2)

  • Perform power analysis to ensure adequate sample sizes

  • Consider both statistical and biological significance

  • Implement appropriate transformations for non-normal data

For network analysis specifically, follow the methodology outlined in the research literature, organizing genes by node degree and applying multiple ranking methods via cytoHubba to identify significant interactions .

How can I determine if PA3275 is a suitable antimicrobial target?

Evaluating PA3275 as a potential antimicrobial target requires systematic assessment of key criteria:

  • Essentiality validation:

    • Confirm gene essentiality through multiple experimental approaches

    • Evaluate essentiality across different growth conditions

    • Apply conditional expression systems as described in patent literature

  • Selectivity assessment:

    • Perform co-occurrence analysis to ensure the target is absent from the host

    • Conduct detailed sequence and structural comparisons with human proteins

    • Evaluate potential for off-target effects

  • Druggability evaluation:

    • Analyze AlphaFold structure for potential binding pockets

    • Assess accessibility considering membrane localization

    • Consider amenability to different drug modalities

  • Target validation framework:

    • Apply the multi-criteria approach outlined in network analysis literature :

      • Log fold change ≥2

      • FDR ≤0.01

      • High node degree in interaction networks

      • Top ranking by at least six different cytoHubba methods

      • Membership in multiple network clusters

      • Absence in host organism

  • Risk assessment:

    • Evaluate potential for resistance development

    • Consider impact on commensal bacteria

    • Assess technical feasibility of drug development

This comprehensive evaluation framework helps determine whether PA3275 represents a viable antimicrobial target worthy of further development efforts .

How can I validate proper folding of recombinant PA3275?

Ensuring proper folding of membrane proteins like PA3275 is critical for meaningful functional studies:

Given PA3275's small size (109 amino acids) , combining CD spectroscopy for secondary structure verification with SEC analysis for homogeneity assessment provides an efficient initial validation approach.

What methods can determine the cellular localization and topology of PA3275?

Accurate determination of membrane protein localization and topology provides crucial insights into function:

  • Fluorescent protein fusion techniques:

    • C-terminal GFP fusion for localization studies

    • Split-GFP complementation for topology determination

    • Time-lapse imaging to monitor dynamic localization

  • Biochemical approaches:

    • Subcellular fractionation followed by Western blotting

    • Protease accessibility assays to determine exposed regions

    • Substituted cysteine accessibility method (SCAM) for topology mapping

  • Advanced microscopy techniques:

    • Super-resolution microscopy for precise localization

    • Confocal microscopy with co-localization studies

    • Fluorescence recovery after photobleaching (FRAP) for mobility assessment

For membrane proteins like PA3275, combining multiple complementary approaches provides the most reliable localization and topology information.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.