Recombinant Pseudomonas aeruginosa UPF0114 protein PA4574 (PA4574)

What is the structural composition of PA4574 protein?

PA4574 is a full-length protein (162 amino acids) with the sequence: MERFFENAMYASRWLLAPIYMGLSLALLALTIKFFQEIFHVIPNIFAMAEADLILVLLSLIDMALVGGLLVMVMISGYENFVSQLDIDEGKEKLSWLGKMDSGSLKNKVAASIVAISSIHLLRIFMDAKNVPDNKLMWYVIIHMTFVLSAFAMGYLDKQTRH . Based on sequence analysis, PA4574 contains multiple hydrophobic regions consistent with a membrane-associated protein structure. The protein belongs to the UPF0114 family, which remains functionally uncharacterized despite conservation across various bacterial species. The hydrophobicity pattern suggests multiple transmembrane domains, likely contributing to its membrane localization and potential role in membrane transport or signaling.

How is recombinant PA4574 protein typically expressed and purified?

Recombinant PA4574 is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The expression protocol generally involves:

• Transformation of expression vector containing the PA4574 gene into a suitable E. coli strain

• Culture growth to optimal density before induction

• Protein expression induction using IPTG or similar inducers

• Cell harvesting and lysis

• Affinity chromatography purification using Ni-NTA or similar matrices that bind the His-tag

• Purity assessment by SDS-PAGE (>90% purity is typically achieved)

For optimal results, researchers should consider testing multiple expression conditions, including temperature, induction time, and inducer concentration, as membrane proteins can be challenging to express in soluble form.

What are the optimal storage conditions for purified PA4574 protein?

Purified PA4574 protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . For long-term storage, the addition of glycerol to a final concentration of 30-50% is recommended before aliquoting and storing at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided as they may cause protein denaturation and aggregation. For working aliquots, storage at 4°C for up to one week is acceptable . Prior to use, vials should be briefly centrifuged to bring contents to the bottom, and the lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

How does PA4574 relate to other membrane transport systems in Pseudomonas aeruginosa?

While PA4574's precise function remains uncharacterized, analysis of other transport systems in P. aeruginosa provides context for understanding its potential role. P. aeruginosa PA14 contains multiple transport systems, including the well-studied NppA1A2BCD (PA14_41110-PA14_41160) ABC transporter, which is involved in the uptake of peptidyl nucleoside antibiotics . Comparative genomic analysis suggests that PA4574 may function in membrane transport processes, potentially contributing to nutrient acquisition or antibiotic resistance mechanisms similar to the NppA1A2BCD system. Researchers investigating PA4574 should consider exploring protein-protein interactions with known transport components to elucidate its functional network.

What methodologies are most effective for characterizing PA4574 function in Pseudomonas aeruginosa?

Multiple complementary approaches are recommended for characterizing PA4574 function:

• Gene knockout studies: Creating a PA4574 deletion mutant using techniques similar to those employed for nppBCD knockout in PA14 . This involves:

  • Amplifying flanking regions of the target gene

  • Creating fusion products with antibiotic resistance markers

  • Using pEX18Ap or similar vectors for homologous recombination

• Complementation assays: Reintroducing PA4574 on plasmids like pBBR1MCS-5 to verify phenotype restoration .

• Protein localization: Using fluorescent protein fusions or immunolocalization to determine subcellular localization.

• Transport assays: Measuring substrate transport in wild-type versus knockout strains.

• Structural studies: Employing techniques like X-ray crystallography or cryo-EM to determine protein structure.

How might PA4574 contribute to Pseudomonas aeruginosa virulence mechanisms?

PA4574's potential role in virulence can be assessed through multiple experimental frameworks. P. aeruginosa PA14 contains various virulence determinants, including the recently characterized R-body producing genes (reb cluster), which contribute to pathogenicity in diverse hosts . Although PA4574 is not directly identified as part of the reb cluster, membrane proteins often contribute to virulence through:

• Transport of essential nutrients during host colonization

• Efflux of host antimicrobial compounds

• Secretion of virulence factors

• Sensing host environments and triggering adaptive responses

Researchers should investigate PA4574 expression during infection of different host models (plant, nematode, mammalian) using techniques similar to those employed for reb gene studies . Furthermore, virulence assays comparing wild-type and PA4574 knockout strains in infection models would provide direct evidence of its contribution to pathogenicity.

What are the optimal protocols for generating PA4574 knockouts in Pseudomonas aeruginosa?

The most effective approach for generating PA4574 knockouts involves a strategy similar to that used for the nppBCD knockout in P. aeruginosa PA14 :

• Design flanking primers: Create primers that amplify approximately 500-bp sequences flanking the 5' and 3' regions of PA4574. Include restriction sites to facilitate subsequent cloning steps.

• PCR amplification: Amplify flanking regions using high-fidelity DNA polymerase such as Phusion with 5% DMSO supplementation .

• Fragment fusion: Perform fusion PCR or use Gibson Assembly to join the flanking fragments with an antibiotic resistance cassette (e.g., gentamicin resistance).

• Vector construction: Clone the fusion product into a suicide vector like pEX18Ap .

• Transformation: Transform the construct into E. coli, then transfer to P. aeruginosa through conjugation or electroporation.

• Selection: Select for single and double crossover events using appropriate antibiotics.

• Verification: Confirm the knockout by PCR with primers flanking the deletion site and sequencing .

How can researchers effectively analyze PA4574 protein interactions and binding partners?

To identify and characterize PA4574 protein interactions:

• Co-immunoprecipitation: Use antibodies against the His-tag or PA4574 itself to pull down protein complexes from cell lysates.

• Bacterial two-hybrid assays: Employ systems like the adenylate cyclase-based two-hybrid system to screen for potential interacting partners.

• Cross-linking mass spectrometry: Use chemical cross-linkers to stabilize protein interactions followed by mass spectrometry identification.

• Proximity-dependent biotin labeling (BioID): Fuse PA4574 to a biotin ligase to identify proximal proteins in the native environment.

• Surface plasmon resonance: For confirming and quantifying specific interaction candidates.

Researchers should initially focus on testing interactions with components of known transport systems in P. aeruginosa, particularly membrane proteins involved in antibiotic transport, given the significance of such systems in this pathogen .

What experimental designs are most appropriate for investigating PA4574 expression under different environmental conditions?

To comprehensively investigate PA4574 expression regulation:

• Transcriptional reporter fusions: Create fusions of the PA4574 promoter region with reporters like GFP or luciferase.

• RT-qPCR analysis: Quantify PA4574 mRNA levels under different conditions.

• RNA-seq: Perform transcriptome analysis to identify co-regulated genes and potential regulatory networks.

• Proteomics: Use quantitative proteomics to measure protein abundance changes.

• Chromatin immunoprecipitation (ChIP): Identify transcription factors binding to the PA4574 promoter.

Environmental conditions to test should include:

• Nutrient limitation (carbon, nitrogen, phosphate)

• Antibiotic exposure (particularly peptidyl nucleoside antibiotics)

• Host-relevant conditions (serum, tissue culture media, host cell co-culture)

• Biofilm versus planktonic growth

• Oxygen limitation

This approach parallels the methods used to study expression of the reb cluster genes in P. aeruginosa during host colonization .

How might PA4574 be exploited as a therapeutic target against Pseudomonas aeruginosa infections?

PA4574's potential as a therapeutic target stems from several considerations:

• Membrane localization: As a predicted membrane protein, PA4574 may be accessible to antibody or small molecule targeting.

• Potential transport function: If involved in essential nutrient acquisition, inhibiting PA4574 could restrict bacterial growth in host environments.

• Possible virulence role: If PA4574 contributes to virulence, targeting it could reduce pathogenicity without creating strong selective pressure.

Research approaches should include:

• High-throughput screening of compound libraries against recombinant PA4574

• Structure-based drug design if crystal structures become available

• Peptide inhibitor development targeting extracellular domains

• Monoclonal antibody development for immunotherapy

• Evaluation of target conservation across P. aeruginosa clinical isolates

These approaches align with current strategies targeting bacterial transport systems, such as those investigating the NppA1A2BCD transporter's role in antibiotic uptake .

What role might PA4574 play in antibiotic resistance mechanisms in Pseudomonas aeruginosa?

P. aeruginosa contains multiple transport systems implicated in antibiotic resistance, including ABC transporters that can act as antibiotic efflux pumps or, conversely, facilitate antibiotic uptake . To investigate PA4574's potential role in antibiotic resistance:

• Susceptibility testing: Compare minimum inhibitory concentrations (MICs) of various antibiotic classes between wild-type and PA4574 knockout strains.

• Antibiotic accumulation assays: Measure intracellular accumulation of fluorescent antibiotics or radiolabeled compounds.

• Expression analysis: Determine if PA4574 expression changes in response to antibiotic exposure or in resistant clinical isolates.

• Transport assays: Develop in vitro systems to measure potential transport activity using recombinant protein in proteoliposomes.

Research should focus particularly on peptidyl nucleoside antibiotics like pacidamycin, albomycin, and blasticidin S, which are known substrates of related transport systems in P. aeruginosa .

What strategies can address poor yield or solubility of recombinant PA4574 protein?

Membrane proteins like PA4574 often present challenges in recombinant expression. Researchers encountering poor yield or solubility should consider:

• Expression system optimization:

  • Test alternative E. coli strains (BL21(DE3), C41/C43, Rosetta)

  • Explore lower induction temperatures (16-20°C)

  • Reduce inducer concentration

  • Use auto-induction media

• Solubilization approaches:

  • Screen different detergents (DDM, LDAO, Triton X-100)

  • Test detergent-lipid mixtures

  • Consider membrane scaffold proteins for nanodisc formation

• Fusion tag strategies:

  • Test alternative tags (MBP, SUMO, GST) that may enhance solubility

  • Optimize tag position (N- or C-terminal)

• Refolding protocols:

  • If inclusion bodies form, develop refolding protocols using mild detergents and controlled dialysis

• Co-expression options:

  • Co-express with chaperones (GroEL/ES, DnaK/J) to assist folding

Current protocols recommend reconstitution in deionized sterile water to 0.1-1.0 mg/mL and addition of glycerol to 50% final concentration for storage , but these parameters may require optimization.

How can researchers address specificity concerns in functional studies of PA4574?

Ensuring specificity in functional characterization of PA4574 requires:

• Multiple complementary knockout approaches:

  • Clean deletion mutants

  • Conditional knockdowns (if PA4574 is essential)

  • CRISPR interference for precise targeting

• Comprehensive complementation:

  • Wild-type gene complementation

  • Point mutant complementation to identify critical residues

  • Heterologous expression in surrogate hosts

• Controlled expression:

  • Use of native promoter versus inducible promoters

  • Quantification of expression levels to avoid artifacts from overexpression

• Multiple phenotypic assays:

  • Growth in different media

  • Antibiotic susceptibility profiles

  • Virulence in different host models

  • Membrane permeability assessments

• Specific antibodies:

  • Develop PA4574-specific antibodies for localization and interaction studies

  • Validate antibody specificity using knockout strains

These approaches build upon methodologies successfully applied in studies of other P. aeruginosa membrane proteins and transport systems, such as those used to characterize the NppA1A2BCD transporter's substrate specificity .