Recombinant Pseudomonas aeruginosa UPF0114 protein PSPA7_5214 (PSPA7_5214)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudomonas aeruginosa UPF0114 Protein PSPA7_5214

The Recombinant Pseudomonas aeruginosa UPF0114 protein PSPA7_5214, hereafter referred to as PSPA7_5214, is a recombinant protein derived from the bacterium Pseudomonas aeruginosa, specifically strain PA7. This protein is part of the UPF0114 family, which is involved in various cellular processes, though specific functions may vary depending on the organism and context.

Expression and Production

PSPA7_5214 is produced through recombinant DNA technology, where the gene encoding the protein is inserted into a suitable host organism, such as Escherichia coli, and expressed under controlled conditions. The protein is then purified and prepared for use in research or other applications.

Expression Region

The expression region for PSPA7_5214 spans from amino acid 1 to 162, indicating that the full-length protein is produced.

Table: Key Features of PSPA7_5214

FeatureDescription
SpeciesPseudomonas aeruginosa (strain PA7)
Uniprot NumberA6VBW1
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C or -80°C
Amino Acid SequenceProvided above
Expression Region1-162

References

  1. Gene Biosystems. Recombinant Pseudomonas aeruginosa UPF0114 protein PSPA7_5214. [Accessed: 2024-09-16] .

  2. Uniprot. A6VBW1 - PSPA7_5214 protein. [Accessed: 2024].

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PSPA7_5214; UPF0114 protein PSPA7_5214
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain PA7)
Target Names
PSPA7_5214
Target Protein Sequence
MERFFENAMYASRWLLAPIYMGLSLALLALTIKFFQEIFHVIPNIFAMAEADLILVLLSL IDMALVGGLLVMVMISGYENFVSQLDIDEGKEKLNWLGKMDSGSLKNKVAASIVAISSIH LLRIFMDAKNVPDNKLMWYVIIHMTFVLSAFAMGYLDKQTRH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is recombinant PSPA7_5214 protein typically expressed and purified?

Recombinant PSPA7_5214 protein is most commonly expressed using E. coli expression systems . The production process involves:

  • Cloning the full-length gene sequence (1-162 aa) into a suitable expression vector

  • Transformation into E. coli host cells optimized for recombinant protein expression

  • Induction of protein expression under controlled conditions

  • Cell lysis and extraction of the recombinant protein

  • Purification via affinity chromatography, typically using the His-tag for immobilized metal affinity chromatography (IMAC)

The purified protein typically achieves greater than 90% purity as determined by SDS-PAGE analysis . While E. coli is the predominant expression system, alternative expression platforms including yeast, baculovirus-infected insect cells, or mammalian cell systems may be employed for specific experimental requirements .

What are the optimal storage conditions for preserving PSPA7_5214 protein activity?

To maintain optimal activity and stability of recombinant PSPA7_5214 protein, the following storage conditions are recommended:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • For reconstituted protein, prepare aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For long-term storage, add glycerol (final concentration 6-50%) and store at -20°C/-80°C

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

The protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided through careful aliquoting of the reconstituted protein .

What functional roles has PSPA7_5214 been implicated in within Pseudomonas aeruginosa biology?

While the precise function of PSPA7_5214 has not been fully characterized, its classification as a UPF0114 family protein suggests potential roles in membrane-associated processes. The protein's amino acid sequence indicates multiple transmembrane domains, suggesting it may function in:

  • Membrane integrity maintenance

  • Small molecule transport across the cell membrane

  • Signaling pathways involving membrane components

Research on related Pseudomonas aeruginosa membrane proteins indicates potential involvement in antibiotic resistance mechanisms and virulence pathways . For instance, other membrane-associated proteins in P. aeruginosa have been linked to ABC transport systems that mediate uptake of peptidyl nucleoside antibiotics . While direct evidence for PSPA7_5214's participation in these processes is limited in the current literature, the protein's sequence and predicted structure suggest similar functional possibilities.

How can recombinant PSPA7_5214 be utilized in vaccine development research against Pseudomonas aeruginosa?

Recombinant PSPA7_5214 has potential applications in vaccine development against Pseudomonas aeruginosa, a multidrug-resistant pathogen associated with serious hospital-acquired infections . Experimental approaches include:

  • Antigen identification and characterization: PSPA7_5214 can be evaluated as a potential vaccine antigen through immunogenicity studies, determining if it elicits protective antibody responses .

  • Bionanoparticle development: Research on P. aeruginosa outer-membrane-vesicle (OMV) vaccines demonstrates that recombinant proteins can be incorporated into OMVs to generate enhanced immune responses. Similar approaches could be applied to PSPA7_5214 .

  • Multi-epitope vaccine design: PSPA7_5214 epitopes could be combined with other P. aeruginosa antigens to create multi-epitope vaccines targeting multiple virulence factors simultaneously.

In recent studies, recombinant P. aeruginosa proteins incorporated into OMVs demonstrated up to 70% protection in animal challenge models . This suggests that properly formulated recombinant proteins can induce protective immunity against P. aeruginosa infection.

What experimental methods are most effective for studying PSPA7_5214 protein-protein interactions?

Investigating protein-protein interactions of PSPA7_5214 requires specialized approaches due to its membrane-associated nature. Recommended methodological approaches include:

  • Co-immunoprecipitation (Co-IP): Utilizing anti-His antibodies to precipitate PSPA7_5214 and identify binding partners through mass spectrometry. This approach has successfully identified protein-protein interactions in other P. aeruginosa membrane proteins .

  • Yeast two-hybrid system with membrane adaptations: Modified membrane yeast two-hybrid systems can overcome limitations of traditional Y2H for membrane proteins.

  • Biolayer interferometry (BLI) or surface plasmon resonance (SPR): These techniques allow real-time, label-free detection of protein-protein interactions with purified recombinant PSPA7_5214.

  • Protein crosslinking coupled with mass spectrometry: This approach can capture transient interactions in native membrane environments.

  • Bacterial two-hybrid systems: These have been successfully employed to study interactions between bacterial membrane proteins and could be adapted for PSPA7_5214.

When designing these experiments, researchers should account for the hydrophobic nature of PSPA7_5214 and incorporate appropriate detergents or membrane mimetics to maintain the protein in its native conformation .

What analytical techniques are recommended for confirming the structural integrity of recombinant PSPA7_5214?

To ensure the structural integrity and proper folding of recombinant PSPA7_5214, researchers should employ multiple complementary analytical techniques:

  • SDS-PAGE and Western blotting: Basic validation of protein size, purity (>90% recommended), and identity using anti-His antibodies .

  • Circular dichroism (CD) spectroscopy: Analysis of secondary structure elements to confirm proper protein folding, particularly important for membrane proteins.

  • Size exclusion chromatography (SEC): Assessment of protein homogeneity and oligomeric state.

  • Mass spectrometry: Confirmation of exact molecular weight and potential post-translational modifications.

  • Functional assays: Development of activity assays based on predicted function to confirm biological activity.

For membrane proteins like PSPA7_5214, additional techniques such as differential scanning calorimetry (DSC) or differential scanning fluorimetry (DSF) can provide insights into protein stability and the effects of buffer conditions or ligands on protein folding .

What are the most common challenges in expressing and purifying functional PSPA7_5214, and how can they be addressed?

Expressing and purifying membrane-associated proteins like PSPA7_5214 presents several challenges that require specific troubleshooting approaches:

ChallengeManifestationSolution Approach
Low expression levelsPoor yield after purificationOptimize codon usage for expression host; test different promoters; lower induction temperature (16-25°C)
Protein aggregationInclusion body formationExpress at lower temperatures; add solubility enhancers (e.g., sorbitol, glycerol); use solubility tags (e.g., MBP, SUMO)
Improper foldingLoss of functional activityInclude molecular chaperones; optimize redox environment; use specialized E. coli strains (e.g., Origami)
Proteolytic degradationMultiple bands on SDS-PAGEAdd protease inhibitors; use protease-deficient host strains; optimize extraction conditions
Difficult solubilizationPoor extraction from membrane fractionTest different detergents (DDM, LDAO, OG); optimize detergent:protein ratio; consider native nanodiscs

For PSPA7_5214 specifically, expression in E. coli has been successful when using an N-terminal His-tag and purification under denaturing conditions, followed by controlled refolding . Including 6% trehalose in the storage buffer enhances stability .

How can researchers design experiments to investigate the potential role of PSPA7_5214 in antibiotic resistance mechanisms?

To investigate PSPA7_5214's potential role in antibiotic resistance, researchers could implement the following experimental design:

  • Gene knockout/knockdown studies:

    • Generate PSPA7_5214 deletion mutants in P. aeruginosa

    • Assess changes in minimum inhibitory concentrations (MICs) for various antibiotic classes

    • Perform complementation studies to confirm phenotype specificity

  • Protein overexpression analysis:

    • Create strains overexpressing PSPA7_5214

    • Determine if increased expression correlates with altered antibiotic susceptibility

  • Transport assays:

    • Develop fluorescently labeled antibiotic uptake assays

    • Compare uptake rates between wild-type and PSPA7_5214 mutant strains

    • Investigate if PSPA7_5214 functions similarly to known antibiotic transporters like the NppA1A2BCD system

  • Protein localization studies:

    • Generate fluorescently tagged PSPA7_5214 to determine subcellular localization

    • Assess co-localization with known resistance determinants

  • Clinical isolate correlation:

    • Analyze PSPA7_5214 expression levels in resistant vs. susceptible clinical isolates

    • Sequence the gene from diverse isolates to identify potential resistance-associated polymorphisms

This multi-faceted approach would provide comprehensive insights into whether PSPA7_5214 contributes to antibiotic resistance mechanisms in P. aeruginosa .

What methods can be used to evaluate the immunogenicity of PSPA7_5214 for vaccine development?

Evaluating the immunogenicity of PSPA7_5214 for vaccine development requires a systematic approach spanning in silico, in vitro, and in vivo methodologies:

  • In silico epitope prediction:

    • Use computational tools to identify B-cell and T-cell epitopes within PSPA7_5214

    • Assess epitope conservation across diverse P. aeruginosa strains

    • Predict MHC-binding affinity of potential epitopes

  • In vitro antibody generation and characterization:

    • Immunize animals with purified recombinant PSPA7_5214

    • Generate monoclonal antibodies against specific epitopes

    • Evaluate antibody binding affinity and specificity using ELISA, SPR, or BLI

  • Functional antibody assays:

    • Opsonophagocytosis assays to assess antibody-mediated bacterial clearance

    • Complement-dependent cytotoxicity assays

    • Neutralization assays if PSPA7_5214 has a known virulence function

  • Cellular immunity assessment:

    • T-cell proliferation assays in response to PSPA7_5214 stimulation

    • Cytokine profiling to characterize Th1/Th2/Th17 responses

    • Adoptive transfer experiments to evaluate protective capacity

  • In vivo protection studies:

    • Challenge immunized animals with virulent P. aeruginosa

    • Assess survival rates, bacterial burden, and inflammatory markers

    • Compare protection with established vaccine candidates

This comprehensive approach would determine whether PSPA7_5214 is a viable vaccine antigen against P. aeruginosa infections, similar to evaluations performed for other recombinant P. aeruginosa proteins .

What synergies exist between PSPA7_5214 research and studies on Pseudomonas aeruginosa outer membrane vesicles (OMVs)?

Research on PSPA7_5214 complements studies on P. aeruginosa outer membrane vesicles (OMVs) in several important ways:

  • Protein incorporation into OMVs: As a membrane-associated protein, PSPA7_5214 may naturally incorporate into OMVs produced by P. aeruginosa. Studies have demonstrated that recombinant proteins can be engineered to increase their presence in OMVs, enhancing their immunogenicity .

  • Vaccine development platforms: P. aeruginosa OMVs are being explored as vaccine platforms, with recombinant strain PA-m14 designed to eliminate virulence factors while enhancing immunogenic properties. PSPA7_5214 could potentially be incorporated into such systems as an additional antigen .

  • Functional studies: OMVs represent a natural membrane environment that may maintain PSPA7_5214 in its native conformation, facilitating functional studies that are challenging with purified recombinant protein.

  • Delivery systems: OMVs can function as natural delivery vehicles for membrane proteins like PSPA7_5214, potentially enhancing immune responses compared to soluble protein formulations.

Research has shown that immunization with engineered P. aeruginosa OMVs carrying specific antigens provided up to 70% protection against intranasal challenge in animal models . This suggests that incorporating PSPA7_5214 into OMV-based vaccine platforms could be a promising approach if the protein proves immunogenic.

How can researchers integrate PSPA7_5214 studies within the broader context of Pseudomonas aeruginosa pathogenesis research?

Integration of PSPA7_5214 research into the broader understanding of P. aeruginosa pathogenesis requires a multidisciplinary approach:

  • Systems biology integration:

    • Incorporate PSPA7_5214 into protein-protein interaction networks

    • Analyze transcriptomic data to identify conditions that modulate PSPA7_5214 expression

    • Create metabolic models that include PSPA7_5214's potential role in nutrient acquisition

  • Virulence mechanism studies:

    • Evaluate PSPA7_5214 expression during infection using in vivo transcriptomics

    • Assess contribution to biofilm formation, a key virulence determinant

    • Investigate potential roles in host-pathogen interactions

  • Comparative genomics approaches:

    • Analyze PSPA7_5214 conservation across clinical isolates from various infection sites

    • Identify potential correlations between sequence variations and virulence phenotypes

    • Compare with homologs in other pathogens to derive functional insights

  • Multi-omics integration:

    • Combine proteomics, transcriptomics, and metabolomics data to place PSPA7_5214 in functional pathways

    • Use this integrated approach to generate testable hypotheses about PSPA7_5214 function

  • Collaborative research frameworks:

    • Establish research consortia focusing on membrane protein characterization

    • Share reagents, mutant strains, and experimental protocols to accelerate discoveries

By placing PSPA7_5214 research within this broader context, researchers can contribute to the comprehensive understanding of P. aeruginosa pathogenesis while addressing specific questions about this understudied protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.