Recombinant Pseudomonas aeruginosa UPF0761 membrane protein PA0951 (PA0951)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
PA0951; UPF0761 membrane protein PA0951
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-411
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
PA0951
Target Protein Sequence
MREHFNDGVEFARFLAHRFVTDKAPNSAAALTYTTLFAVVPMMTVMFSMLSLIPAFHGMG ESIQTFIFRNFVPSAGEAVETYLKSFTTQARHLTWVGVVFLAVTAFTMLVTIEKAFNEIW RVRQPRRGVGRFLLYWAILSLGPLLLGAGFAVTTYITSLSLLHGPDALPGAETLLGLMPL AFSVAAFTLLYSAVPNARVPVRHALMGGVFTAVLFEAAKTLFGLYVSLFPGYQLIYGAFA TVPIFLLWIYLSWMIVLFGAVLVCNLSSSRLWRRRSLPKLIVLLGVLRVFLQRQQLGQSL RLTHLHRAGWLLPEDEWEELLDFLEKEQFVCRAGGGEWVLCRDLGAYSLHRLLNRCPWPM PSRERMPASLDEAWYPPFQQAMERLQVEQEALFGESLAHWLADGTSGAKVT
Uniprot No.

Target Background

Database Links

KEGG: pae:PA0951

STRING: 208964.PA0951

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is PA0951 gene expression regulated in different P. aeruginosa strains?

The regulation of PA0951 expression varies between reference strains such as PAO1 and PA14, with potential strain-specific regulatory mechanisms. In PAO1, which was the first P. aeruginosa strain to have its genome fully sequenced, expression may be influenced by different environmental conditions compared to the more virulent PA14 strain . To investigate this regulation:

  • Perform qRT-PCR analysis under various growth conditions (aerobic vs. anaerobic, different media compositions)

  • Create transcriptional reporter fusions (PA0951 promoter::GFP/lux)

  • Analyze expression in PAO1 vs. PA14 to identify strain-specific differences

  • Examine transcriptional changes in clinical isolates compared to reference strains

When designing these experiments, it's crucial to consider that P. aeruginosa demonstrates high phenotypic plasticity and environmental adaptability . Growth conditions should mimic relevant infection environments, such as synthetic cystic fibrosis medium (SCFM) for CF-related studies.

What experimental approaches can determine the subcellular localization of PA0951?

To determine the precise subcellular localization of PA0951:

TechniqueMethodologyAdvantagesLimitations
Fluorescent protein fusionC/N-terminal GFP/mCherry taggingVisualization in live cellsPotential interference with protein function
Immunogold labelingAntibody-based detection with EMHigh precision localizationRequires fixed cells
Cell fractionationSeparation of membrane componentsQuantitative analysisPotential contamination between fractions
Protease accessibilityLimited proteolysis of surface-exposed regionsIdentifies topologyRequires specific protease optimization

The choice of reference strain is critical as PAO1 and PA14 may exhibit differences in membrane composition that could affect protein localization patterns . For robust results, implement complementary approaches and validate findings across multiple P. aeruginosa isolates.

How should researchers optimize recombinant expression systems for PA0951?

Optimizing recombinant expression of a membrane protein like PA0951 requires careful consideration of expression systems:

  • Expression Host Selection:

    • E. coli BL21(DE3) for standard expression

    • C41/C43(DE3) strains specifically engineered for membrane proteins

    • P. aeruginosa-derived expression systems for native-like membrane environment

  • Expression Vector Design:

    • Incorporate affinity tags (His6, FLAG) for purification

    • Consider fusion partners (MBP, SUMO) to enhance solubility

    • Employ inducible promoters with titratable expression

  • Cultivation Conditions:

    • Lower induction temperatures (16-20°C)

    • Extended expression periods (24-48 hours)

    • Specialized media formulations to enhance membrane protein folding

When analyzing expression results, implement comparative analyses between different conditions rather than relying on single parametric measurements4. Monitor not just total protein yield but also quality metrics like monodispersity and functional activity.

What are the critical considerations when designing mutagenesis studies for PA0951?

When designing mutagenesis studies for PA0951, consider:

  • Target Selection Strategy:

    • Conserved residues identified through phylogenetic analysis

    • Predicted functional domains based on bioinformatic analyses

    • Tryptophan residues, which are often crucial for membrane protein function and anchoring

    • Regions unique to pathogenic strains when comparing PAO1 and PA14 genomes

  • Mutation Approach:

    • Alanine scanning for identifying functionally important residues

    • Conservative substitutions (maintaining chemical properties)

    • Domain swapping with homologous proteins

    • Truncation analysis to identify minimal functional units

  • Validation Framework:

    • Complementation assays in PA0951 knockout strains

    • Phenotypic characterization comparing to reference strains

    • Structural integrity assessment using circular dichroism

    • Membrane localization confirmation post-mutation

How can researchers effectively assess the impact of environmental conditions on PA0951 expression and function?

To assess environmental influences on PA0951:

Environmental FactorExperimental ApproachKey Parameters to Monitor
Oxygen availabilityAerobic vs. anaerobic culture systemsGene expression, protein localization, metabolic activity
Growth phaseTime-course sampling through bacterial growth cycleTemporal expression patterns, post-translational modifications
Nutrient availabilityMedia with varying carbon/nitrogen sourcesRegulatory responses, metabolic integration
Biofilm formationStatic vs. flow cell biofilm modelsSpatial expression patterns within biofilm structure

P. aeruginosa demonstrates remarkable metabolic flexibility, particularly in switching between aerobic and anaerobic environments (like those in CF lungs). This transition not only affects metabolism but also virulence factor expression and antibiotic susceptibility . Design experiments that capture these dynamics through component analysis approaches that isolate individual environmental variables while controlling for others4.

How do PA0951 homologs differ between PAO1 and PA14 reference strains?

When comparing PA0951 homologs between PAO1 and PA14:

  • Sequence Analysis:

    • Perform detailed alignment of protein sequences

    • Identify strain-specific amino acid variations

    • Examine conservation of key functional domains

    • Assess potential post-translational modification sites

  • Expression Pattern Comparison:

    • Culture both strains under identical conditions

    • Quantify relative expression using qRT-PCR and western blotting

    • Determine if regulatory mechanisms differ between strains

  • Functional Assessment:

    • Create knockout mutants in both strains

    • Compare resulting phenotypes in various infection models

    • Conduct complementation studies with cross-strain gene substitution

It's important to note that while PA14 is the more virulent strain, it displays high genomic conservation with PAO1 . The key differences may lie in the two pathogenicity islands present in PA14 but absent in PAO1, which carry virulence-associated genes . Determine whether PA0951 function interacts with these virulence pathways through epistasis experiments.

How should researchers interpret differences in PA0951 function between laboratory strains and clinical isolates?

When comparing laboratory reference strains to clinical isolates:

  • Isolate Selection Strategy:

    • Include diverse clinical sources (CF patients, wounds, etc.)

    • Consider temporal isolation points (early vs. chronic infection)

    • Account for treatment history (antibiotic exposure)

  • Analytical Framework:

    • Sequence the PA0951 gene from clinical isolates

    • Compare expression levels under standardized conditions

    • Assess functional parameters against reference baselines

    • Create phylogenetic trees to track evolutionary relationships

  • Interpretation Guidelines:

    • Distinguish adaptation from random genetic drift

    • Account for patient-specific selection pressures

    • Consider the trade-offs between virulence and persistence

Remember that transitioning clinical isolates from clinical settings to laboratory environments introduces genetic and phenotypic changes that must be accounted for . Additionally, the genetic makeup of clinical isolates varies between patients, potentially complicating the wide application of findings . Use this diversity advantageously through comparative analyses that identify convergent adaptations across independent isolates.

What comparative genomic approaches are most informative for understanding PA0951 evolution during chronic infection?

For tracking PA0951 evolution during chronic infection:

  • Longitudinal Sampling Strategy:

    • Collect sequential isolates from the same patient over time

    • Target multiple anatomical sites to assess spatial heterogeneity

    • Preserve isolates with minimal laboratory passage

  • Genomic Analysis Pipeline:

    • Whole genome sequencing of sequential isolates

    • SNP analysis focused on PA0951 and regulatory regions

    • Assessment of genetic elements affecting gene expression

    • Identification of horizontal gene transfer events

  • Evolutionary Interpretation:

    • Calculate mutation rates specific to PA0951

    • Identify signatures of positive or negative selection

    • Compare evolutionary trajectories between patients

    • Correlate genetic changes with clinical outcomes

The analysis of evolutionary trajectories can span over 150,000 bacterial generations in chronic infections . P. aeruginosa populations in chronic infections often diversify into distinct subpopulations with specific phenotypic and genomic features through niche specialization . Determine whether PA0951 variants contribute to this diversification process through targeted genotype-phenotype correlation studies.

What approaches can identify protein interaction partners of PA0951?

To identify interaction partners of PA0951:

TechniqueMethodologyAdvantagesLimitations
Bacterial two-hybridIn vivo detection of protein interactionsWorks with membrane proteinsMay miss weak interactions
Co-immunoprecipitationPull-down of protein complexes with anti-PA0951 antibodiesCaptures native complexesRequires specific antibodies
Proximity labelingBioID or APEX2 fusion for labeling nearby proteinsIdentifies transient interactionsPotential background labeling
Crosslinking mass spectrometryChemical crosslinking followed by MS identificationCaptures interaction interfacesComplex data analysis

For comprehensive interaction mapping, implement a multi-layered approach:

  • Initial screening with bacterial two-hybrid or proximity labeling

  • Validation of key interactions using co-immunoprecipitation

  • Functional confirmation through genetic epistasis studies

  • Structural characterization of critical interactions

Given the importance of membrane proteins in bacterial pathogenicity, interactions between PA0951 and virulence factors should be specifically investigated, particularly in relation to the pathogenicity islands present in PA14 but absent in PAO1 .

How can researchers determine if PA0951 contributes to antimicrobial resistance mechanisms?

To assess PA0951's potential role in antimicrobial resistance:

  • Genetic Manipulation Approaches:

    • Create PA0951 deletion mutants in PAO1 and PA14

    • Generate overexpression strains

    • Develop point mutations in specific functional domains

  • Resistance Assessment:

    • Determine minimum inhibitory concentrations (MICs) for multiple antibiotic classes

    • Assess biofilm formation capacity and antibiotic tolerance

    • Measure persister cell formation rates

    • Evaluate efflux pump activity in wildtype versus mutant strains

  • Mechanistic Studies:

    • Examine membrane permeability alterations

    • Assess changes in gene expression of known resistance factors

    • Investigate metabolic adaptations under antibiotic stress

Resistance mechanisms should be evaluated under both aerobic and anaerobic conditions, as P. aeruginosa metabolism changes significantly between these environments, altering antibiotic susceptibility and biofilm fitness . Consider that PA0951 may interact with multiple resistance mechanisms rather than functioning independently.

What methodologies can determine if PA0951 plays a role in host-pathogen interactions?

To investigate PA0951's potential role in host-pathogen interactions:

  • In Vitro Cell Culture Models:

    • Compare wildtype and PA0951 mutant interactions with:

      • Respiratory epithelial cells

      • Macrophages and neutrophils

      • Wound model systems

    • Measure:

      • Adhesion and invasion efficiency

      • Host cell cytotoxicity

      • Inflammatory cytokine responses

      • Host cell signaling pathway activation

  • Ex Vivo Tissue Models:

    • Human airway epithelial cultures

    • Lung tissue explants

    • Artificial skin constructs

  • In Vivo Infection Models:

    • Acute and chronic murine infection models

    • Galleria mellonella (wax moth) larvae for high-throughput screening

    • Specialized models for CF-relevant studies

P. aeruginosa possesses multiple factors that antagonize host immunity, including flagella and LPS that interact with TLR5 and TLR4 receptors . Determine whether PA0951 influences these interactions or contributes to immune evasion mechanisms. For CF-relevant studies, consider evaluating PA0951's role under conditions mimicking the CF lung, using synthetic cystic fibrosis medium (SCFM) .

What are the most common challenges in purifying recombinant PA0951 and how can they be addressed?

Common challenges and solutions for PA0951 purification:

  • Low Expression Yield:

    • Optimize codon usage for expression host

    • Test multiple fusion tags and positions

    • Evaluate specialized membrane protein expression strains

    • Consider cell-free expression systems

  • Protein Aggregation:

    • Screen multiple detergents systematically (DDM, LMNG, etc.)

    • Implement detergent exchange during purification

    • Add stabilizing lipids during extraction

    • Optimize buffer composition (pH, salt, glycerol content)

  • Functional Loss During Purification:

    • Minimize purification steps

    • Maintain consistent low temperature

    • Add specific cofactors or stabilizing agents

    • Consider nanodiscs or styrene maleic acid lipid particles (SMALPs) for native-like environment

  • Contaminant Proteins:

    • Implement multi-step purification strategy

    • Consider on-column detergent exchange

    • Optimize imidazole gradient for His-tagged constructs

    • Validate final purity by mass spectrometry

When designing purification protocols, employ component analysis to systematically evaluate the impact of each variable (detergent type, concentration, buffer composition) rather than changing multiple parameters simultaneously4.

How can researchers address contradictory results when studying PA0951 function across different experimental systems?

When facing contradictory results:

  • Systematic Evaluation Framework:

    • Create a comprehensive comparison table of experimental conditions

    • Identify all variables that differ between systems (strain background, growth conditions, assay readouts)

    • Test hypotheses about specific variables through controlled experiments

  • Strain Verification:

    • Confirm strain identity through genotyping

    • Sequence PA0951 and regulatory regions

    • Verify expression of PA0951 in each experimental system

  • Methodological Standardization:

    • Establish standard operating procedures for key assays

    • Use identical reagents and consumables across experiments

    • Implement blinded analysis where applicable

  • Integrated Data Analysis:

    • Apply statistical methods appropriate for each data type

    • Consider meta-analysis techniques for conflicting datasets

    • Evaluate context-dependency of PA0951 function

Remember that P. aeruginosa demonstrates high plasticity and environmental adaptability . Variations in the bacterial environment often produce greater metabolic heterogeneity than strain differences , which could explain seemingly contradictory results obtained under different conditions.

What are the best practices for analyzing post-translational modifications of PA0951?

For comprehensive PTM analysis:

Modification TypeDetection MethodSample Preparation ConsiderationsData Analysis Approach
PhosphorylationPhospho-specific antibodies, LC-MS/MS with titanium dioxide enrichmentFlash freezing to preserve modificationsSite localization scoring, occupancy rate calculation
GlycosylationLectins, PNGase F treatment with MSGentle extraction to preserve glycansGlycan structure analysis, site mapping
LipidationClick chemistry, metabolic labelingSpecialized extraction for lipidated proteinsModification site identification
Proteolytic processingN-terminal sequencing, MSProtease inhibitor cocktailsTerminal sequence analysis

Best practices include:

  • Always include appropriate controls (wildtype vs. treatment conditions)

  • Validate MS findings with orthogonal techniques

  • Assess PTM site conservation across P. aeruginosa strains

  • Determine functional consequences through site-directed mutagenesis

For membrane proteins like PA0951, tryptophan residues may be particularly important to analyze, as they often play critical roles in both membrane anchoring and protein function . Consider that mutation of tryptophan residues, even to other hydrophobic amino acids, can lead to loss of activity, expression, and/or post-translational modifications .

How might single-cell analysis techniques advance our understanding of PA0951 expression heterogeneity?

Single-cell technologies offer new insights into PA0951 expression:

  • Single-Cell Transcriptomics:

    • Apply scRNA-seq to P. aeruginosa populations

    • Identify subpopulations with differential PA0951 expression

    • Correlate expression with other virulence factors

    • Map expression patterns in biofilms and during infection

  • Single-Cell Protein Analysis:

    • Implement fluorescent protein fusions for live-cell imaging

    • Apply flow cytometry and cell sorting based on expression level

    • Utilize mass cytometry for multi-parameter analysis

    • Develop microfluidic approaches for temporal monitoring

  • Spatial Transcriptomics:

    • Map PA0951 expression within biofilm structures

    • Correlate spatial expression with microenvironmental conditions

    • Identify localized regulation mechanisms

P. aeruginosa populations in chronic infections develop into coexisting subpopulations with distinct phenotypic and genomic features that colonize separate geographical niches . Single-cell approaches can determine whether PA0951 expression contributes to this diversification and niche specialization, providing insights into bacterial adaptation strategies during chronic infection.

What integrative approaches can connect PA0951 function to broader virulence networks in Pseudomonas aeruginosa?

Integrative approaches to connect PA0951 to virulence networks:

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Construct network models incorporating PA0951

    • Identify regulatory hubs connecting PA0951 to virulence factors

    • Validate key network connections experimentally

  • Systems Biology Framework:

    • Develop mathematical models of PA0951-associated pathways

    • Perform sensitivity analysis to identify critical nodes

    • Generate testable predictions about system behavior

    • Iteratively refine models with experimental data

  • Comparative Virulence Analysis:

    • Evaluate PA0951 contribution across infection models

    • Compare virulence patterns in PAO1 vs. PA14 backgrounds

    • Assess virulence modulation in clinical isolate backgrounds

Researchers should investigate whether PA0951 interacts with the 43 metabolically essential genes that are integrated into the production of virulence factors in PA14, including alginate, lipid A, and pyocyanin . This approach would connect PA0951 function to the broader metabolic and virulence networks of P. aeruginosa.

How can computational approaches advance structure-function relationships for PA0951?

Advanced computational approaches for PA0951 research:

  • Protein Structure Prediction:

    • Apply AlphaFold2 or RoseTTAFold for high-confidence structures

    • Perform molecular dynamics simulations in membrane environments

    • Model protein-protein and protein-ligand interactions

    • Predict functional sites through evolutionary analysis

  • Molecular Mechanism Simulation:

    • Simulate conformational changes during function

    • Model membrane interactions and lipid-protein dynamics

    • Calculate energetics of substrate binding and transport

    • Predict effects of mutations on protein stability and function

  • Deep Learning Applications:

    • Develop models to predict protein-protein interactions

    • Identify novel inhibitors through virtual screening

    • Predict functional consequences of clinical mutations

    • Classify variants of unknown significance

Computational approaches should particularly focus on tryptophan residues within the protein structure, as these amino acids often play critical roles in membrane protein anchoring and function . The asymmetric distribution of tryptophan residues is especially important for membrane protein topology and stability, and computational models can predict how these distributions affect PA0951 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.