Recombinant Pseudomonas aeruginosa UPF0761 membrane protein PLES_43641 (PLES_43641)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Pseudomonas aeruginosa UPF0761 Membrane Protein PLES_43641 (PLES_43641)

Recombinant Pseudomonas aeruginosa UPF0761 membrane protein PLES_43641 (PLES_43641) is a heterologously expressed membrane protein derived from Pseudomonas aeruginosa, a Gram-negative bacterium notorious for causing severe hospital-acquired infections. The protein is classified under the UPF0761 family, a group of uncharacterized proteins with conserved domains but unknown specific functions. Its gene identifier (PLES_43641) and UniProt accession (B7UXY2) confirm its origin in P. aeruginosa strain LESB58 .

Expression Systems

The protein is produced in multiple hosts to optimize yield and folding:

Host SystemAdvantagesLimitationsSources
E. coliHigh yield, cost-effectiveRisk of misfolding, translocation jams
YeastBetter eukaryotic post-translational modificationsLower throughput, higher cost
Baculovirus/MammalianNative-like folding, glycosylationComplex workflows, high cost

Transcriptional Tuning

Studies in E. coli LEMO21(DE3) strains highlight the importance of transcriptional fine-tuning using L-rhamnose to downregulate T7 RNA polymerase activity. This approach improves membrane protein production by balancing translation and folding rates, avoiding Sec-translocon bottlenecks . For example:

  • Optimal L-rhamnose concentration: Varies by protein; moderate levels (e.g., 1–10 µM) often maximize yield .

  • Codon Optimization: Harmonized or codon-optimized variants may enhance production but lack universal efficacy .

Vaccine Antigen Candidate

PLES_43641 is investigated for its potential as a subunit vaccine component. Key findings include:

ApplicationRationaleSupporting Evidence
Outer Membrane Vesicles (OMVs)OMVs encapsulate antigens, enhancing immunogenicityRecombinant OMVs with PH antigens show efficacy in animal models
Adjuvant CombinationsCo-formulation with LPS/exotoxin antigensIC43 vaccine trials reduced P. aeruginosa colonization in ICU patients

Biochemical Characterization

  • Function: Limited functional data; hypothesized roles in membrane integrity or pathogenicity .

  • Interactions: No direct interaction partners identified in public databases .

Production Challenges

ChallengeMitigation Strategy
Low solubilityUse detergents (e.g., DDM, CHAPS) for membrane extraction
MisfoldingCo-express chaperones (e.g., GroEL/GroES) in E. coli
ScalabilityOptimize codon usage and expression vectors

Research Gaps and Opportunities

  1. Functional Elucidation: Structural studies (e.g., cryo-EM) to define PLES_43641’s role in P. aeruginosa virulence.

  2. Vaccine Formulation: Testing PLES_43641 in combination with established antigens (e.g., OprD, OprI) for broader protection .

  3. Antigenic Targeting: Assessing immune responses to PLES_43641 in preclinical models (e.g., murine pneumonia) .

Production Optimization Outcomes

FactorImpact on Yield
L-rhamnose (1 µM)2–10× increase vs. no tuning
Codon HarmonizationVariable improvement (protein-dependent)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PLES_43641; UPF0761 membrane protein PLES_43641
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-411
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain LESB58)
Target Names
PLES_43641
Target Protein Sequence
MREHFNDGVEFARFLAHRFVTDKAPNSAAALTYTTLFAVVPMMTVMFSMLSLIPAFHGMG ESIQTFIFRNFVPSAGEAVETYLKSFTTQARHLTWVGVVFLAVTAFTMLVTIEKAFNEIW RVRQPRRGVGRFLLYWAILSLGPLLLGAGFAVTTYITSLSLLHGPDALPGAETLLGLMPL AFSVAAFTLLYSAVPNARVPVRHALMGGVFTAVLFEAAKTLFGLYVSLFPGYQLIYGAFA TVPIFLLWIYLSWMIVLFGAVLVCNLSSSRLWRRRSLPKLIVLLGVLRVFHQRQQLGQSL RLTHLHRAGWLLPEDEWEELLDFLEKEQFVCRAGGGEWVLCRDLGAYSLHRLLNRCPWPM PSRERMPASLDEAWYPPFQQAMERLQVEQEALFGESLAHWLADGTSGAKVT
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the predicted structural characterization of UPF0761 membrane protein PLES_43641?

The UPF0761 membrane protein PLES_43641 belongs to an uncharacterized protein family in Pseudomonas aeruginosa. Although detailed structural information specific to this protein remains limited, structural prediction can be approached through multiple computational and experimental methods. Based on analysis of other P. aeruginosa membrane proteins, PLES_43641 likely contains hydrophobic transmembrane domains rich in amino acids such as leucine, tyrosine, and phenylalanine that facilitate membrane anchoring . These amino acids, particularly leucine with its alkyl side-chain, contribute non-polar characteristics suited for positioning within the lipid bilayer.

For comprehensive structural characterization, researchers should implement the following approaches:

  • Transmembrane topology prediction using algorithms like TMHMM, Phobius, and MEMSAT

  • Secondary structure prediction through PSIPRED or JPred

  • Homology modeling if suitable templates exist in protein structure databases

  • Ab initio modeling for novel structural elements

  • Molecular dynamics simulations to predict stability and behavior in membrane environments

The amino acid composition analysis would likely show patterns consistent with other P. aeruginosa membrane proteins, with hydrophobic residues concentrated in transmembrane regions and charged/polar residues in exposed domains. For experimental validation, techniques including circular dichroism spectroscopy and limited proteolysis can provide insights into secondary structure and domain organization prior to more intensive structural studies.

What methods are most effective for determining the subcellular localization of PLES_43641?

Determining the precise subcellular localization of PLES_43641 requires a systematic approach combining biochemical fractionation and imaging techniques. P. aeruginosa membrane proteins typically localize to either the inner cytoplasmic membrane (IM) or the outer membrane (OM) . Based on methodologies employed for other P. aeruginosa membrane proteins, the following protocol is recommended:

  • Membrane fractionation through ultracentrifugation in a sucrose density gradient to separate inner and outer membranes

  • Analysis of fractions using specific marker proteins (e.g., NADH oxidase for IM, OprF for OM)

  • Western blotting with antibodies against PLES_43641 to identify its presence in specific fractions

  • Complementary proteomic analysis using Multidimensional Protein Identification Technology (MudPIT) to confirm localization

  • Fluorescence microscopy using GFP-fusion constructs to visualize localization in live cells

The GRAVY index (Grand Average of Hydropathy) provides additional predictive power - proteins with higher GRAVY scores tend to be more hydrophobic and generally associate with the inner membrane, while outer membrane proteins often have intermediate scores due to their β-barrel structures with hydrophilic channels . For confirmation, selective extraction using detergents like sarkosyl, which preferentially solubilizes inner membrane proteins while leaving outer membrane proteins intact, can be employed.

How is the expression of PLES_43641 regulated under different environmental conditions?

The expression of PLES_43641 likely responds to environmental stimuli similarly to other P. aeruginosa membrane proteins. Based on patterns observed with related membrane proteins, expression regulation may involve:

  • Iron availability: Many P. aeruginosa membrane transporters show differential expression under iron-limited conditions, similar to TonB-dependent transporters that are specifically induced during iron restriction

  • Environmental stress responses: Expression may change in response to factors such as:

    • Oxidative stress (through OxyR or SoxR regulators)

    • Osmotic pressure fluctuations (through osmotic stress response pathways)

    • pH changes (through acid/alkaline response systems)

    • Temperature shifts (through heat/cold shock response regulators)

  • Quorum sensing networks: Expression may be coordinated with population density through las, rhl, or pqs quorum sensing systems

To investigate these regulatory mechanisms, researchers should implement:

  • Transcriptomic analysis (RNA-Seq) under various growth conditions

  • Quantitative RT-PCR for targeted expression analysis

  • Reporter gene assays using the PLES_43641 promoter region fused to fluorescent proteins

  • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the promoter

  • Mutagenesis of potential regulatory elements in the promoter region

Expression levels may significantly differ between standard laboratory media and infection-relevant conditions, as observed with other membrane proteins that show low expression in nutrient-rich media but increased expression in infection models . This highlights the importance of studying expression under physiologically relevant conditions.

What are the best approaches for purifying recombinant PLES_43641 while maintaining protein structure and function?

Purifying membrane proteins while preserving their native structure presents significant challenges. For PLES_43641, the following comprehensive strategy is recommended:

  • Expression system selection:

    • E. coli C41(DE3) or C43(DE3) strains designed for toxic membrane proteins

    • P. aeruginosa expression systems for native protein folding environment

    • Cell-free expression systems for direct incorporation into detergent micelles or nanodiscs

  • Optimal extraction protocol:

    • Screening of multiple detergents to identify those that efficiently extract while maintaining stability

    • Detergent concentration optimization to prevent protein aggregation or denaturation

    • Buffer composition adjustment to enhance stability (pH, salt concentration, glycerol)

  • Purification workflow:

    StepApproachCritical Parameters
    Initial captureIMAC (His-tag) or affinity chromatographyDetergent in all buffers, low imidazole in wash
    Intermediate purificationIon exchange chromatographySalt gradient optimization, detergent CMC consideration
    PolishingSize exclusion chromatographyFlow rate, column selection for membrane proteins
    Quality assessmentMulti-angle light scatteringProtein-detergent complex analysis
  • Stability enhancement strategies:

    • Addition of specific lipids that may be required for stability

    • Transition to more stable systems such as nanodiscs, amphipols, or SMALPs

    • Inclusion of stabilizing additives (glycerol, specific ions, ligands)

  • Functional validation:

    • Circular dichroism to confirm secondary structure integrity

    • Thermal shift assays to assess protein stability

    • Functional assays specific to predicted protein activity

The extraction and purification process should be monitored at each step using techniques like Western blotting and activity assays to ensure the protein maintains its native conformation and function throughout the procedure .

What are the optimal extraction methods for isolating PLES_43641 from P. aeruginosa membranes?

Efficient extraction of membrane proteins like PLES_43641 requires specialized techniques to overcome challenges posed by hydrophobicity and membrane integration. Based on successful approaches for P. aeruginosa membrane proteins, the following protocol is recommended:

  • Cell disruption optimization:

    • French press or sonication in buffer containing protease inhibitors

    • Gentle disruption to prevent protein denaturation

    • Maintenance of low temperature throughout processing

  • Membrane fraction preparation:

    • Differential centrifugation to remove unbroken cells and debris

    • Ultracentrifugation to collect total membrane fraction

    • Optional: Sucrose density gradient to separate inner and outer membranes

  • Detergent-based extraction:

    DetergentConcentrationBest ForConsiderations
    n-Dodecyl β-D-maltoside (DDM)1-2%Preserving protein activityRelatively mild, good for functional studies
    Triton X-1000.5-1%High extraction efficiencyMay affect structural integrity
    Lauryldimethylamine oxide (LDAO)0.5-1%Crystallization studiesRelatively harsh but good for stability
    Octylglucoside0.5-1%MS analysisLess interference with mass spectrometry
  • Alternative "shaving" approach:

    • Treatment of intact membranes with trypsin to release exposed peptide domains

    • This technique effectively enriches membrane-exposed peptides while leaving transmembrane domains embedded

    • Particularly useful for topological studies of membrane proteins

  • Selective extraction methods:

    • Carbonate extraction (pH 11) to remove peripherally associated proteins

    • Sarkosyl (0.5%) for selective IM protein solubilization

    • Differential solubilization with increasing detergent concentrations

Following extraction, analysis using MudPIT can identify peptides from complex mixtures, providing valuable insights into membrane protein composition and topology . The specific extraction method should be selected based on the downstream experimental goals and the predicted localization of PLES_43641.

How can MudPIT be optimized for the analysis of PLES_43641 membrane protein domains?

Multidimensional Protein Identification Technology (MudPIT) is particularly valuable for analyzing membrane proteins like PLES_43641. The following optimizations should be implemented for comprehensive characterization:

  • Sample preparation enhancements:

    • Sequential extraction procedures to enrich membrane proteins

    • Multiple protease digestion (trypsin, chymotrypsin, elastase) to improve sequence coverage

    • In-solution digestion protocols optimized for hydrophobic proteins

    • Specialized detergents compatible with MS analysis (e.g., RapiGest, ProteaseMAX)

  • Chromatographic separation improvements:

    • Extended SCX/RP gradient times for improved peptide separation

    • Specialized reverse-phase materials designed for hydrophobic peptides

    • Addition of isopropanol or other organic modifiers to the mobile phase

    • Smaller particle size columns for enhanced resolution

  • Mass spectrometry parameter optimization:

    ParameterRecommendationRationale
    Ionization methodNano-electrosprayEnhanced sensitivity for hydrophobic peptides
    FragmentationCombination of CID, HCD, ETDComprehensive fragmentation patterns
    Dynamic exclusionExtended settings (60-90s)Detection of co-eluting peptides
    AGC target valuesIncreased from standardImproved ion statistics for low-abundance peptides
  • Data analysis considerations:

    • Search against multiple databases (UniProt, custom P. aeruginosa databases)

    • Variable modifications specific to membrane proteins

    • Implement specialized algorithms for transmembrane domain identification

    • Apply rigorous FDR filtering (1% at both peptide and protein levels)

  • Validation strategy:

    • Targeted MS approaches (PRM or MRM) for confirmatory analysis

    • Correlation of spectral count data with other quantification methods

    • Western blotting for final validation of identification

The combination of multiple MudPIT runs (20+ as suggested by research on P. aeruginosa membrane proteins) significantly increases coverage of the membrane proteome . This approach can identify thousands of unique peptides and hundreds of distinct proteins, providing comprehensive characterization of membrane protein domains.

What expression systems are most effective for producing recombinant PLES_43641 for structural studies?

Producing recombinant membrane proteins for structural studies requires careful selection of expression systems to maximize yield while maintaining proper folding. For PLES_43641, consider the following optimized approaches:

  • Bacterial expression systems:

    SystemAdvantagesOptimization Strategies
    E. coli C41/C43(DE3)Specifically designed for toxic membrane proteinsLow temperature induction (16-20°C), low IPTG concentrations
    E. coli Lemo21(DE3)Tunable expression levelL-rhamnose titration to control expression
    P. aeruginosa hostNative folding environmentUse of native promoters, inducible systems
    B. subtilisGood secretion capacitySignal sequence optimization
  • Eukaryotic expression systems for complex membrane proteins:

    • Pichia pastoris: High density culture and strong promoters

    • Insect cells (Sf9/Hi5): Post-translational modifications and complex membrane proteins

    • Mammalian cells: Native-like membrane environment and complex glycosylation

  • Expression optimization parameters:

    • Fusion partners: MBP, SUMO, or Mistic tags to improve solubility and membrane targeting

    • Codon optimization for the selected expression host

    • Signal sequence engineering for proper membrane targeting

    • Co-expression with chaperones (GroEL/ES, DnaK/J) to assist folding

  • Scale-up considerations:

    • Bioreactor parameters (dissolved oxygen, pH control, feeding strategy)

    • Induction timing and harvesting point optimization

    • Cell disruption methods preserving protein integrity

    • Extraction efficiency monitoring through activity assays

  • Construct design strategies:

    • Truncation constructs removing flexible regions

    • Thermostability-enhancing mutations

    • Surface entropy reduction for crystallization

    • Introduction of affinity tags in less conserved regions

For highest probability of success, parallel screening of multiple expression systems with various constructs is recommended. Small-scale expression trials followed by detergent extraction screening can quickly identify promising conditions before scaling up production. Functional and structural validation should be performed at each step to ensure the recombinant protein maintains native characteristics.

What are the challenges in crystallizing PLES_43641 and strategies to overcome them?

Crystallizing membrane proteins like PLES_43641 presents unique challenges compared to soluble proteins. Researchers should implement the following comprehensive strategy:

  • Pre-crystallization protein engineering:

    • Surface entropy reduction through mutation of flexible residues

    • Removal of disordered termini through construct optimization

    • Introduction of stabilizing mutations identified through alanine scanning

    • Fusion with crystallization chaperones (T4 lysozyme, BRIL, or antibody fragments)

  • Detergent screening and optimization:

    Detergent ClassExamplesBenefitsConsiderations
    MaltosidesDDM, UDM, NMGentle extraction, stabilityLarge micelle size
    GlucosidesOG, NGSmaller micelles, better crystalsMore denaturing
    Neopentyl glycolsLMNG, DMNGHigh stability, small micellesHigher cost
    Facial amphiphilesMNA-C12, FA-3Unique micelle propertiesSpecialized applications
  • Alternative membrane-mimetic systems:

    • Lipidic cubic phase (LCP) crystallization for better membrane protein packing

    • Bicelle systems combining detergents and lipids

    • Nanodiscs for stabilization prior to crystallization

    • Polymer-based systems like amphipols or SMALPs

  • Crystallization screening strategies:

    • Specialized sparse matrix screens designed for membrane proteins

    • Systematic grid screens around promising conditions

    • Microseeding to improve crystal nucleation and growth

    • Lipid addition to stabilize native protein conformation

  • Crystal optimization approaches:

    • Additive screening to improve crystal quality

    • Controlled dehydration to tighten crystal packing

    • Temperature optimization during crystal growth

    • Post-crystallization treatments to improve diffraction quality

When conventional crystallization fails, alternative structural approaches should be considered, including cryo-electron microscopy (increasingly powerful for membrane proteins), NMR spectroscopy (for smaller membrane proteins or domains), and computational modeling. Success in crystallizing membrane proteins often requires testing hundreds of conditions and may take considerably longer than for soluble proteins, demanding systematic optimization at each step of the process.

What approaches can determine the role of PLES_43641 in antibiotic resistance?

Membrane proteins in P. aeruginosa play crucial roles in antibiotic resistance through various mechanisms. To investigate PLES_43641's potential contribution to resistance, implement the following systematic approach:

  • Genetic manipulation strategies:

    • Gene deletion using allelic exchange or CRISPR-Cas9

    • Controlled expression systems (inducible promoters)

    • Point mutations of key functional residues

    • Complementation studies to confirm phenotypes

  • Antimicrobial susceptibility testing:

    MethodApplicationsParameters MeasuredAdvantages
    Broth microdilutionMIC determinationGrowth inhibitionQuantitative, reproducible
    Disk diffusionRapid screeningInhibition zone diameterSimple, cost-effective
    Time-kill assaysKilling kineticsBacterial survival over timeDynamic resistance information
    Checkerboard assaysDrug interactionsFractional inhibitory concentrationSynergy/antagonism detection
  • Resistance mechanism investigation:

    • Membrane permeability assays using fluorescent dyes

    • Antibiotic accumulation studies (uptake/efflux balance)

    • Expression analysis of known resistance genes in mutants

    • Protein-protein interaction studies with known resistance machinery

  • Clinical relevance assessment:

    • Comparison of PLES_43641 sequence/expression in resistant vs. susceptible isolates

    • Correlation of mutations with resistance phenotypes

    • Testing under infection-relevant conditions

    • Analysis of resistance development during antibiotic exposure

P. aeruginosa's intrinsic resistance is largely attributed to membrane-associated proteins that protect bacterial cells from antibiotics . Research has shown that membrane proteins can contribute to resistance through altered permeability, active efflux, or modification of drug targets. Understanding PLES_43641's specific role in these mechanisms could identify targets for adjuvant therapies that enhance antibiotic efficacy against this challenging pathogen.

How does PLES_43641 potentially contribute to P. aeruginosa virulence?

P. aeruginosa membrane proteins often play significant roles in virulence through direct host interactions or by supporting virulence factor production. To characterize PLES_43641's contribution to virulence, implement these approaches:

  • Infection model studies:

    • Cell culture models (epithelial cells, macrophages)

    • Invertebrate models (Galleria mellonella, Caenorhabditis elegans)

    • Mammalian models (acute and chronic infection)

    • Comparison of wild-type vs. PLES_43641 mutant strains

  • Virulence factor production assessment:

    Virulence FactorAssay MethodRelevance
    ElastaseElastin Congo red assayTissue damage
    PyocyaninChloroform extraction, spectrophotometryOxidative stress induction
    RhamnolipidsTLC, hemolysis assaySurfactant activity, cytotoxicity
    ExotoxinsELISA, cell cytotoxicityHost cell damage
  • Host interaction characterization:

    • Adhesion to relevant cell types and extracellular matrix components

    • Invasion assays in epithelial cells

    • Biofilm formation capacity on biotic and abiotic surfaces

    • Resistance to host defense mechanisms (complement, antimicrobial peptides)

  • Immune response analysis:

    • Cytokine/chemokine profiling during infection

    • Neutrophil recruitment and activation studies

    • Inflammasome activation assessment

    • Adaptive immune response development

  • Virulence gene network mapping:

    • Transcriptome analysis of mutant vs. wild-type strains

    • Identification of co-regulated genes during infection

    • Protein interaction studies with known virulence factors

    • Regulatory network reconstruction

P. aeruginosa surface-exposed proteins represent the first molecules involved in pathogen-host interactions and play crucial roles in infection mechanisms . If PLES_43641 is located in the outer membrane with exposed domains, it may directly interact with host receptors or immune components, affecting both bacterial virulence and host responses to infection.

What techniques can identify protein-protein interactions involving PLES_43641?

Understanding PLES_43641's protein interaction network is crucial for elucidating its functional role. Implement the following comprehensive approach to map its interactome:

  • In vivo interaction detection methods:

    TechniquePrincipleAdvantagesLimitations
    Bacterial two-hybridReconstitution of transcription factorIn vivo detectionLimited to binary interactions
    Split-protein complementationReconstitution of reporter proteinDirect visualization in bacteriaPotential for false positives
    Chemical crosslinking with MSCovalent linkage of interacting proteinsCaptures weak/transient interactionsComplex data analysis
    Co-immunoprecipitationAntibody-based complex isolationPreserves native interactionsRequires specific antibodies
  • Membrane-specific interaction approaches:

    • Membrane yeast two-hybrid systems

    • Proximity labeling (BioID, APEX) in bacterial systems

    • Fluorescence resonance energy transfer (FRET)

    • Surface plasmon resonance with purified components

  • Bioinformatic prediction methods:

    • Coevolution analysis to identify co-evolving protein pairs

    • Genomic context methods (gene neighborhood, gene fusion)

    • Text mining of literature for potential interactions

    • Structure-based prediction of interaction interfaces

  • Interaction validation strategies:

    • Reciprocal co-immunoprecipitation

    • Site-directed mutagenesis of predicted interaction sites

    • Functional assays demonstrating biological relevance

    • In vitro binding assays with purified components

  • Network analysis and visualization:

    • Integration of experimental and predicted interactions

    • Identification of functional modules within the network

    • Comparison with known protein complexes in P. aeruginosa

    • Pathway enrichment analysis of interacting partners

The membrane environment presents special challenges for interaction studies, necessitating approaches specifically adapted for membrane proteins. Multiple complementary techniques should be employed to build confidence in the identified interactions, with particular attention to distinguishing specific interactions from non-specific membrane associations.

How do environmental conditions affect PLES_43641 expression and function?

Environmental factors significantly impact P. aeruginosa membrane protein expression patterns. To characterize how PLES_43641 responds to various conditions, implement this systematic approach:

  • Transcriptional regulation analysis:

    • qRT-PCR under various growth conditions

    • RNA-Seq for global transcriptional context

    • Promoter-reporter fusions for real-time monitoring

    • Chromatin immunoprecipitation to identify regulators

  • Environmental stress conditions to investigate:

    ConditionRelevanceExperimental SetupAnalysis Methods
    Iron limitationHost environment mimickingChelators (2,2'-dipyridyl)Gene expression, protein levels
    Oxidative stressImmune responseH₂O₂, paraquat exposureStress response activation
    Antibiotic exposureTreatment responseSub-MIC antibioticsResistance development
    Biofilm vs. planktonicInfection modesFlow cell/static systemsSpatial gene expression
    Host-relevant mediaIn vivo conditionsArtificial sputum, serumVirulence factor production
  • Post-transcriptional regulation assessment:

    • mRNA stability under different conditions

    • Small RNA regulation identification

    • Translational efficiency analysis

    • Protein turnover rates in various environments

  • Functional adaptation characterization:

    • Protein localization changes under stress

    • Post-translational modifications induced by environmental conditions

    • Protein-protein interaction network remodeling

    • Activity assays under different conditions

Research has shown that expression of P. aeruginosa membrane proteins can be significantly affected by environmental conditions, as observed with TonB-dependent transporters that are induced under iron-restricted conditions or during infection . Similar expression patterns might be observed for PLES_43641, potentially linking its function to specific stress responses or host adaptation mechanisms. Understanding these environmental responses can provide insights into the protein's role during infection and identify conditions for optimal experimental study.

What post-translational modifications occur in PLES_43641 and how do they affect function?

Post-translational modifications (PTMs) can significantly influence membrane protein function and interactions. For comprehensive characterization of PLES_43641 PTMs, implement the following analytical approach:

  • Mass spectrometry-based PTM identification:

    • Enrichment strategies for specific modifications (phosphopeptides, glycopeptides)

    • Multiple protease digestion to maximize sequence coverage

    • High-resolution MS/MS with multiple fragmentation methods

    • Specialized search algorithms optimized for PTM identification

  • Common bacterial membrane protein PTMs to investigate:

    ModificationEnrichment MethodFunctional ImpactDetection Challenges
    PhosphorylationTiO₂, IMACSignaling, protein interactionsLow stoichiometry
    GlycosylationLectin affinityStability, host interactionHeterogeneity
    LipidationHydrophobic interactionMembrane anchoringExtraction difficulties
    Proteolytic processingN-terminal enrichmentActivation, maturationReference sequence uncertainty
  • Site-specific functional analysis:

    • Site-directed mutagenesis of modified residues

    • Phosphomimetic mutations (Ser/Thr to Asp/Glu)

    • Non-modifiable mutations (Ser/Thr to Ala)

    • Functional assays comparing wild-type and mutant proteins

  • PTM regulation investigation:

    • Environmental conditions affecting modification status

    • Identification of enzymes responsible for modifications

    • Temporal dynamics of modifications during growth and stress

    • Cross-talk between different modification types

  • Structural impact assessment:

    • Molecular dynamics simulations with modified residues

    • Conformational changes induced by modifications

    • Effects on protein-protein or protein-ligand interactions

    • Alterations in membrane topology or embedding

The integration of high-resolution proteomics with targeted validation experiments will provide a comprehensive view of PTMs affecting PLES_43641, offering insights into its regulation and potential signaling functions. Particular attention should be paid to modifications that change in response to environmental conditions, as these may be most relevant to the protein's function during infection.

How does PLES_43641 contribute to biofilm formation and antibiotic tolerance?

Biofilm formation is a critical virulence and persistence mechanism for P. aeruginosa. To characterize PLES_43641's role in biofilm development and associated antibiotic tolerance, implement these approaches:

  • Biofilm formation assessment:

    • Crystal violet assays for biomass quantification

    • Confocal laser scanning microscopy for 3D architecture analysis

    • Flow cell systems for dynamic biofilm development

    • Mixed-species biofilm interactions

  • Matrix component analysis:

    ComponentQuantification MethodRole in BiofilmPLES_43641 Impact Assessment
    ExopolysaccharidesPhenol-sulfuric acid, specific stainingStructural supportChanges in production or composition
    Extracellular DNAFluorometric quantification, DNase sensitivityStructural integrity, HGTRelease mechanisms, binding properties
    Matrix proteinsProteomic analysis, immunodetectionAdhesion, stabilizationDirect contribution or regulation
    RhamnolipidsTLC, surface tension measurementMaintenance, dispersionProduction changes in mutants
  • Antibiotic tolerance mechanisms:

    • Minimum biofilm eradication concentration (MBEC) determination

    • Persister cell quantification in biofilms

    • Penetration assays using fluorescent antibiotics

    • Metabolic activity profiling within biofilm layers

  • Regulatory network integration:

    • c-di-GMP signaling pathway components

    • Quorum sensing system activation

    • Stress response regulation in biofilms

    • Transcriptomic profiling of biofilm vs. planktonic cells

  • Host-relevant biofilm assessment:

    • Formation on relevant biological surfaces

    • Response to host defense factors

    • Inflammatory response to biofilm components

    • In vivo biofilm infection models

If PLES_43641 is involved in surface sensing or adhesion, it may directly contribute to the initial stages of biofilm formation. Alternatively, it could affect biofilm development through regulatory pathways or by influencing the production of matrix components. Understanding these mechanisms could identify new targets for anti-biofilm strategies against this difficult-to-eradicate pathogen.

What is the immunogenic potential of PLES_43641 for vaccine development?

Evaluating PLES_43641 as a potential vaccine antigen requires a systematic assessment from computational prediction through experimental validation:

  • In silico epitope prediction and analysis:

    • B-cell and T-cell epitope identification using IEDB resources

    • Conservation analysis across P. aeruginosa strains

    • Epitope accessibility prediction based on protein topology

    • Population coverage assessment based on MHC binding predictions

  • Recombinant protein production strategies:

    Expression StrategyAdvantagesConsiderationsApplications
    Full-length proteinComplete epitope repertoirePurification challengesComprehensive immunogenicity testing
    Selected domainsImproved solubilityMay miss conformational epitopesFocused immune response
    Synthetic peptidesPrecise epitope targetingLimited to linear epitopesEpitope mapping, focused vaccines
    Multi-epitope constructsBroader coverageDesign complexityEnhanced presentation of key epitopes
  • Immunogenicity testing protocol:

    • Humoral response assessment (antibody titers, isotype distribution)

    • T-cell response characterization (proliferation, cytokine profiles)

    • Functional antibody testing (opsonophagocytosis, neutralization)

    • Memory response evaluation following boosting

  • Protection studies in animal models:

    • Acute pneumonia model

    • Chronic lung infection model

    • Wound infection model

    • Challenge with diverse P. aeruginosa strains

  • Adjuvant and delivery optimization:

    • Comparison of adjuvant formulations

    • Evaluation of delivery systems (liposomes, nanoparticles)

    • Mucosal vs. systemic administration

    • Prime-boost strategies

How does PLES_43641 participate in host-pathogen interactions during infection?

Understanding PLES_43641's role in host-pathogen interactions requires integrating molecular, cellular, and immunological approaches:

  • Host cell interaction analysis:

    • Adhesion assays with relevant cell types

    • Invasion quantification in epithelial models

    • Cytotoxicity assessment in various cell types

    • Intracellular survival in professional phagocytes

  • Host recognition and immune response:

    Immune MechanismAssessment MethodPotential PLES_43641 RoleSignificance
    Pattern recognitionReporter cell lines, TLR knockout modelsPAMP activityInnate immune activation
    Inflammasome activationIL-1β secretion, pyroptosis measurementActivator or suppressorInflammatory response
    Complement interactionSerum resistance, C3b depositionBinding or evasionSurvival in blood
    Adaptive immunityT-cell responses, antibody developmentAntigen presentationLong-term protection
  • Immune evasion characterization:

    • Phagocytosis resistance mechanisms

    • Complement inhibition strategies

    • Cytokine response modulation

    • Antigen variation or masking

  • In vivo pathogenesis studies:

    • Bacterial burden in different tissues

    • Host survival and disease progression

    • Histopathological analysis of infected tissues

    • Immune cell recruitment and activation

  • Host environment adaptation:

    • Transcriptional responses to host factors

    • Metabolic adaptations during infection

    • Stress response activation in host environments

    • Phenotypic changes promoting persistence

Surface-exposed proteins in P. aeruginosa represent the first molecules involved in pathogen-host interactions and play a critical role in infection mechanisms . If PLES_43641 is surface-exposed, it may directly interact with host receptors or immune factors, potentially serving as a molecular target for host recognition or as a bacterial factor that modulates host responses to promote bacterial survival and persistence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.