Recombinant Pseudomonas aeruginosa UPF0761 membrane protein PSPA7_4558 (PSPA7_4558)

What is the complete amino acid sequence of PSPA7_4558?

The full amino acid sequence of Pseudomonas aeruginosa UPF0761 membrane protein PSPA7_4558 consists of 411 amino acids as follows:

MREHFNDGIEFARFLAHRFVTDKAPNSAAALTYTTLFAVVPMMTVMFSMLSLIPAFHGMGESIQTFIFRNFVPSAGEAVETYLKSFTTQARHLTWVGVVFLAVTAFTMLVTIEKAFNEIWRVRQPRRGVGRFLLYWAILSLGPLLLGAGFAVTTYITSLSLLHGPDALPGAETLLGLMPLAFSVAAFTLLYSAVPNARVPVRHALMGGMFTAVLFEAAKTLFGLYVSLFPGYQLIYGAFATVPIFLLWIYLSWMIVLFGAVLVCNLSSSRLWRRRSLPKPIVLLGVLRVFHQRQQLGQSMRLVHLHRAGWLLPEDEWEELLDFLEKEQFVCRVGGGEWVLCRDLGSYSLHRLLNRCPWPMPSRERMPAQLDEAWYPAFQQAMERLQAEQERLFGESLAHWLAEGNASAKVT

When designing experiments involving this protein, researchers should consider that this sequence represents the full-length protein without any modifications. For functional studies, it may be important to ensure the complete sequence is properly expressed to maintain native structure and function.

What expression systems are recommended for PSPA7_4558 production?

Based on established protocols, E. coli represents the preferred expression system for recombinant PSPA7_4558 production . The available recombinant versions typically include an N-terminal His-tag to facilitate purification .

When implementing this expression system, researchers should:

• Select appropriate E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3) or Lemo21)

• Consider induction conditions carefully, as membrane proteins often benefit from lower induction temperatures (16-20°C)

• Test multiple detergents during extraction and purification to identify optimal solubilization conditions

• Verify protein folding through functional assays, as membrane proteins can misfold during heterologous expression

For experimental design, variable manipulation should include testing different growth media compositions, induction points, and purification strategies to optimize yield of properly folded protein .

What storage conditions maximize PSPA7_4558 stability?

PSPA7_4558 stability is best maintained through proper storage protocols. The lyophilized form of the protein offers the greatest stability for long-term storage . Recommended storage procedures include:

• Store the lyophilized powder at -20°C/-80°C upon receipt

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (with 50% being optimal) to prevent freeze-thaw damage

• Aliquot the reconstituted protein to minimize freeze-thaw cycles

• Store working aliquots at 4°C for up to one week

The stock buffer composition typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . Researchers should note that repeated freeze-thaw cycles significantly degrade membrane proteins and should therefore be avoided through proper aliquoting strategies.

What purification methods are most effective for PSPA7_4558?

As PSPA7_4558 is typically produced with a His-tag, affinity chromatography represents the primary purification method . A methodological approach to purification should include:

• Initial capture using Ni-NTA or IMAC affinity chromatography

• Detergent screening to identify optimal solubilization conditions

• Buffer optimization to maintain protein stability during purification

• Secondary purification steps such as size exclusion chromatography to achieve higher purity

• Quality control assessment through SDS-PAGE (>90% purity is typically achievable)

When designing purification protocols, researchers should consider that membrane proteins often require specific detergent concentrations above their critical micelle concentration to remain soluble while preserving native structure.

What functional assays are appropriate for characterizing PSPA7_4558 activity?

While specific functional information for PSPA7_4558 is limited in the available literature, methodological approaches for characterizing UPF0761 family membrane proteins typically include:

• Membrane integration assays to confirm proper localization

• Protein-protein interaction studies using pull-down assays or yeast two-hybrid systems

• Lipid binding assays to identify potential interactions with membrane components

• Structural analyses using circular dichroism to assess secondary structure composition

• Potential transport assays if the protein functions as a transporter

Experimental design for functional characterization should employ a systematic approach with appropriate controls. Researchers should initially establish baseline functional parameters and then proceed to more complex analyses . Since PSPA7_4558 is classified as an "UPF" (Uncharacterized Protein Family) protein, determining its function represents a significant research opportunity requiring careful experimental design.

How can researchers identify potential interaction partners of PSPA7_4558?

Identifying interaction partners requires systematic experimental approaches. Methodological strategies include:

• Affinity purification coupled with mass spectrometry (AP-MS)

  • Express tagged PSPA7_4558 in appropriate Pseudomonas strains

  • Perform crosslinking to capture transient interactions

  • Purify protein complexes using tag-based affinity methods

  • Identify co-purifying proteins through mass spectrometry

• Yeast two-hybrid screening

  • Create bait constructs with PSPA7_4558 domains

  • Screen against Pseudomonas aeruginosa genomic libraries

  • Validate interactions through secondary confirmation methods

• Proximity-based labeling approaches (BioID, APEX)

  • Express PSPA7_4558 fused to a proximity labeling enzyme

  • Identify proteins in close proximity through biotinylation

  • Purify and identify labeled proteins

When designing interaction studies, researchers should consider experimental controls including:

• Non-specific binding controls using unrelated membrane proteins

• Domain-specific constructs to map interaction regions

• Validation through reciprocal pull-down experiments

The experimental design should incorporate randomization of samples to prevent batch effects and ensure reproducibility .

What structural analysis techniques are most suitable for PSPA7_4558?

As a membrane protein, PSPA7_4558 presents unique structural analysis challenges. Researchers should consider a hierarchical approach:

Experimental design considerations should include:

• Detergent screening to identify conditions that maintain native structure

• Construct optimization to identify stable domains

• Lipid reconstitution to mimic native membrane environment

• Control experiments with known membrane proteins of similar size

Researchers should employ a systematic variable manipulation approach to optimize conditions for each structural technique .

How can PSPA7_4558 be effectively incorporated into model membrane systems for functional studies?

For mechanistic studies of membrane proteins like PSPA7_4558, reconstitution into model membrane systems provides a controlled environment. Methodological approaches include:

• Liposome reconstitution

  • Prepare liposomes with defined lipid composition

  • Incorporate purified PSPA7_4558 using detergent-mediated methods

  • Remove detergent through dialysis or adsorption

  • Verify incorporation through proteoliposome flotation assays

• Nanodiscs preparation

  • Assemble nanodiscs with membrane scaffold proteins and lipids

  • Incorporate PSPA7_4558 during nanodisc formation

  • Purify PSPA7_4558-containing nanodiscs by size exclusion chromatography

  • Confirm protein orientation using protease protection assays

• Supported lipid bilayers

  • Form bilayers on solid supports (e.g., mica, glass)

  • Incorporate PSPA7_4558 through vesicle fusion or direct reconstitution

  • Analyze protein behavior using surface-sensitive techniques

Experimental design should include controls for:

• Protein:lipid ratios to optimize incorporation efficiency

• Lipid composition to mimic bacterial membrane environments

• Orientation control to ensure physiologically relevant topology

• Function verification through appropriate assays after reconstitution

These approaches provide a platform for studying PSPA7_4558 in a controlled membrane environment that can be systematically manipulated to understand structure-function relationships .

What experimental approaches can determine PSPA7_4558's role in Pseudomonas aeruginosa pathogenicity?

Understanding PSPA7_4558's potential role in pathogenicity requires multi-faceted experimental approaches:

• Gene knockout and complementation studies

  • Generate PSPA7_4558 deletion mutants in P. aeruginosa

  • Assess phenotypic changes in virulence models

  • Complement with wild-type and mutant versions to confirm specificity

• Infection models

  • Compare wild-type and PSPA7_4558 mutant strains in relevant infection models

  • Assess bacterial burden, host response, and pathogenicity markers

  • Analyze tissue-specific effects during infection progression

• Transcriptomic and proteomic profiling

  • Compare expression profiles between wild-type and mutant strains

  • Identify co-regulated genes during infection conditions

  • Discover potential regulatory networks involving PSPA7_4558

Experimental design considerations should include:

• Proper randomization of experimental groups

• Blinded assessment of infection outcomes

• Appropriate statistical power calculations for animal studies

• Multiple time points to capture dynamic processes

• Controls for potential polar effects in genetic manipulations

These methodological approaches provide complementary data on PSPA7_4558's potential role in virulence while adhering to rigorous experimental design principles .

What controls are essential when working with recombinant PSPA7_4558?

Rigorous experimental design for PSPA7_4558 studies requires comprehensive controls:

• Expression controls

  • Empty vector controls to account for expression system effects

  • Alternative tagged proteins to validate tag-specific behaviors

  • Wild-type vs. mutant constructs to establish structure-function relationships

• Functional controls

  • Heat-inactivated protein to distinguish active vs. passive effects

  • Known membrane proteins with similar characteristics for comparative analysis

  • Concentration gradients to establish dose-dependent effects

• Technical controls

  • Multiple biological replicates to ensure reproducibility

  • Different protein preparations to account for batch variation

  • Different expression lots to minimize preparation artifacts

When designing experiments, researchers should implement variable manipulation systematically, manipulating independent variables (e.g., protein concentration, buffer conditions) to observe effects on dependent variables (e.g., binding affinity, activity) . This approach helps establish causality through proper experimental design.

How should researchers design experiments to investigate PSPA7_4558 topology in membranes?

Membrane protein topology determination requires multiple complementary approaches:

• Protease accessibility assays

  • Treat intact membrane vesicles with proteases

  • Identify protected fragments through Western blotting

  • Compare with detergent-solubilized samples to identify protected domains

• Substituted cysteine accessibility method (SCAM)

  • Introduce cysteine residues at predicted transmembrane boundaries

  • Treat with membrane-impermeable sulfhydryl reagents

  • Identify accessible regions through labeling patterns

• Fluorescence-based approaches

  • Introduce fluorescent probes at specific positions

  • Measure environmental sensitivity of fluorescence

  • Determine membrane-embedded vs. solvent-exposed regions

Experimental design should incorporate:

• Multiple prediction algorithms to establish topology hypotheses

• Systematic mutation of key residues throughout the protein

• Complementary techniques to validate findings

• Controls with known membrane proteins of established topology

• Randomization of sample analysis to prevent bias

These methodological approaches provide convergent evidence for PSPA7_4558 membrane topology while adhering to rigorous experimental design principles .

What considerations should guide experimental design for post-translational modification analysis of PSPA7_4558?

Investigating potential post-translational modifications (PTMs) of PSPA7_4558 requires careful experimental design:

• Mass spectrometry-based approaches

  • Digest purified protein with multiple proteases to maximize coverage

  • Use different fragmentation methods (CID, ETD, HCD) for comprehensive analysis

  • Implement label-free and isotope-labeled quantification for modification stoichiometry

  • Compare different growth conditions to identify regulated modifications

• Targeted analysis of specific modifications

  • Phosphorylation: Use phospho-specific antibodies and phosphatase treatments

  • Glycosylation: Employ glycosidase digestions and lectin-based detection

  • Lipid modifications: Apply fatty acid analysis and click chemistry approaches

• Site-directed mutagenesis validation

  • Mutate putative modification sites to non-modifiable residues

  • Assess functional consequences through activity assays

  • Compare with wild-type protein under identical conditions

Experimental design considerations should include:

• Appropriate controls including unmodified recombinant protein

• Multiple biological replicates to account for modification heterogeneity

• Comparison between heterologous and native expression systems

• Technical controls for each modification-specific detection method

These approaches facilitate comprehensive analysis of PSPA7_4558 PTMs through rigorous experimental design and methodology .