Recombinant Pseudomonas entomophila Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Role in Cobalamin Biosynthesis

CobS catalyzes the adenosylation of cobyrinic acid during the final steps of vitamin B12 synthesis. This process is conserved across aerobic and anaerobic pathways :

Aerobic Pathway (e.g., P. denitrificans)Anaerobic Pathway (e.g., Salmonella)
Requires oxygen for cobalt insertionCobalt inserted early; oxygen-independent
CobS mediates Co(II) → Co(I) reductionCobS homologs (CbiP/CobA) handle adenosylation
Final steps: Adenosylcobyric acid → AdoCblSimilar adenosylation mechanism

Recombinant Production and Applications

Recombinant CobS is expressed in E. coli systems for biochemical studies. Key production details include :

  • Expression region: Amino acids 1–244 (full-length protein).

  • Tags: Variable (determined during production).

  • Purity: Optimized for ELISA and structural studies.

Applications span:

  1. Enzyme kinetics: Studying adenosylation mechanisms in B12 biosynthesis .

  2. Structural biology: Resolving 3D structures to inform drug design .

  3. Metabolic engineering: Enhancing B12 production in industrial strains .

Research Findings

  • Genetic conservation: cobS orthologs exist in 337 bacterial genera, highlighting evolutionary conservation .

  • Regulatory interplay: CobS expression is indirectly influenced by the RsmY/RsmZ small RNAs and RsmA1/RsmA2 proteins via the Gac pathway .

  • Biocontrol potential: While P. entomophila’s entolysin and Monalysin dominate virulence studies, CobS supports metabolic versatility in soil and host environments .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific needs. If you require a particular format, please specify it in your order notes. We will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on your purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know. We will prioritize developing the specified tag if feasible.
Synonyms
cobS; PSEEN1387; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Pseudomonas entomophila (strain L48)
Target Names
cobS
Target Protein Sequence
MLPFWIALQFLSSLPVRLPGMPTPNEMGRSLLFYPVVGLLFGLLLWLASHLLQGAPAPLH AALLLALWVLLSGALHLDGLADSADAWLGGFGDRERTLQIMKDPRSGPIAVVVLVLVLLL KFCALWVLVERGTGGWLVLAPVVGRAAMLGLFMGTPYVRKGGLGAALAEHLPRRAAGWVL LGSVLGCVVLGGSPGLWMLLLSLGVFLWLRRLMCKRLGGTTGDTAGAMVELLELAVLVGL ALMV
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from *Pseudomonas entomophila* catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin), an essential cofactor for various metabolic reactions. Specifically, it joins adenosylcobinamide-GDP and alpha-ribazole to generate Ado-cobalamin. Additionally, it can synthesize adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of cobalamin synthase (CobS) in P. entomophila?

Cobalamin synthase (CobS) in P. entomophila, like its homologs in other bacteria such as Salmonella, catalyzes the penultimate step in adenosylcobalamin (vitamin B12) biosynthesis. Specifically, CobS functions as a cobalamin-5'-phosphate synthase, joining adenosylcobinamide-GDP with α-ribazole-5'-phosphate to form adenosylcobalamin-5'-phosphate (AdoCbl-5'-P) . This reaction represents a critical convergence point in the pathway where the activated corrin ring and lower ligand base are condensed. The membrane association of CobS is conserved among all cobamide producers, suggesting its evolutionary importance in the biosynthetic pathway .

Why is CobS membrane-associated and what implications does this have for research?

The membrane association of CobS is conserved across all cobamide-producing bacteria and archaea, suggesting a fundamental physiological importance that remains incompletely understood . For researchers, this membrane association presents both challenges and opportunities. Experimentally, it means that CobS must be studied in a lipid environment to fully understand its function. Studies with Salmonella CobS have demonstrated that its activity increases significantly when inserted into a lipid bilayer, indicating that the membrane environment is crucial for optimal enzyme function . For researchers working with P. entomophila CobS, this necessitates specialized techniques for membrane protein extraction, purification, and reconstitution into liposomes or other membrane mimetics to study its function in a physiologically relevant context.

What are the optimal conditions for expressing recombinant P. entomophila CobS in E. coli?

For membrane proteins like CobS, expression optimization requires careful consideration of several factors. Based on studies with Salmonella CobS, a successful expression strategy would likely involve:

  • Vector selection: Use of low-copy vectors (like pBAD or pET derivatives with tunable promoters) to prevent toxicity from membrane protein overexpression

  • Host strain optimization: E. coli C41(DE3) or C43(DE3) strains are generally preferable for membrane proteins as they tolerate membrane protein expression better than standard BL21(DE3)

  • Induction parameters: Lower temperatures (16-20°C) and reduced inducer concentrations (0.1-0.5 mM IPTG for T7 systems or 0.002-0.02% arabinose for araBAD promoters) often yield better results by slowing expression and allowing proper membrane insertion

  • Growth media: Enriched media like Terrific Broth supplemented with glucose (0.4%) during growth phase followed by inducer addition

  • Additives: Inclusion of 1% glycerol in the media can help stabilize membrane proteins during expression

Since CobS function has been shown to be enhanced in liposomes, co-expression with membrane-stabilizing proteins or expression in the presence of specific phospholipids might also improve yield and functionality .

What purification protocol yields the highest purity and activity for membrane-bound CobS?

Purification of CobS requires specialized approaches for membrane proteins. Based on recent advances with Salmonella CobS purification, the following protocol is recommended:

  • Membrane isolation: Harvest cells and disrupt by French press or sonication, followed by differential centrifugation to isolate membrane fractions (typically 100,000×g for 1 hour)

  • Solubilization: Solubilize membranes using a gentle detergent such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration (typically 1% DDM)

  • Affinity purification: If using a His-tagged construct, purify via nickel-affinity chromatography with detergent (0.05% DDM) maintained in all buffers

  • Size exclusion chromatography: Further purify by gel filtration to remove aggregates and achieve high homogeneity (>96% as achieved with Salmonella CobS)

  • Reconstitution: For functional studies, reconstitute purified CobS into liposomes composed of E. coli polar lipids (or synthetic mixtures containing phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin at ratios similar to bacterial membranes)

This approach has been shown to yield highly homogeneous and functionally active CobS protein from Salmonella , and would likely be applicable to P. entomophila CobS with minor modifications based on protein-specific behaviors.

How can researchers confirm proper folding and membrane insertion of recombinant CobS?

Confirming proper folding and membrane insertion of recombinant CobS is crucial for ensuring the biological relevance of subsequent functional studies. Multiple complementary approaches should be employed:

  • Circular dichroism (CD) spectroscopy: To assess secondary structure content and compare with predicted membrane protein topology

  • Proteoliposome reconstitution and activity assays: Functional reconstitution into liposomes followed by activity testing is the gold standard for confirming proper folding. For Salmonella CobS, this has been accomplished using a bioassay where growth of a ΔcobS strain embedded in agar overlay was dependent on the product of CobS proteoliposome reactions

  • Limited proteolysis: Properly folded membrane proteins show distinct proteolytic patterns compared to misfolded variants

  • Thermal shift assays: Modified for detergent-solubilized proteins to assess stability

  • Immunoblotting with conformation-specific antibodies: When available, can confirm native-like structure

  • Fluorescence-based assays: Intrinsic tryptophan fluorescence or applied fluorescent probes can detect tertiary structure formation

These methods collectively provide strong evidence for proper membrane protein folding and insertion, which is essential before proceeding to detailed mechanistic studies.

What assays can be used to measure CobS enzymatic activity in vitro?

Several complementary assays can be employed to measure CobS enzymatic activity:

  • HPLC-based product detection: The gold standard assay involves incubating purified CobS (preferably in proteoliposomes) with substrates adenosylcobinamide-GDP and α-ribazole-5'-phosphate, followed by HPLC separation and UV-visible spectroscopic detection of adenosylcobalamin-5'-phosphate . This allows quantitative measurement of product formation with specific activity calculated in nmol of product per minute per mg of protein.

  • Radioactive substrate incorporation: Using radiolabeled substrates (typically 14C or 3H-labeled) allows for highly sensitive detection of product formation through scintillation counting after separation steps.

  • Coupled enzyme assays: By linking CobS activity to subsequent enzymatic reactions that produce detectable signals.

  • Bioassays: Functional complementation using ΔcobS bacterial strains grown in media supplemented with reaction products. Growth restoration indicates production of biologically active AdoCbl-5'-P .

  • Mass spectrometry: LC-MS/MS analysis to definitively identify reaction products and potential intermediates.

For Salmonella CobS, specific activities of 8-22 nmol of product per minute per mg of protein have been reported in cell-free extract assays , providing a benchmark for comparing P. entomophila CobS activity.

How does the lipid environment affect CobS activity and what lipid composition is optimal?

The lipid environment significantly impacts CobS activity, as demonstrated by studies with Salmonella CobS showing enhanced function when reconstituted into liposomes . For optimal activity characterization:

  • Lipid composition testing: Systematically vary lipid compositions to determine preference. Initial screening should include:

    • E. coli total polar lipid extract (as a physiologically relevant starting point)

    • Defined mixtures of phosphatidylethanolamine (PE), phosphatidylglycerol (PG), and cardiolipin (CL) at ratios mimicking bacterial membranes (typically 70:20:10)

    • Variations in PE:PG:CL ratios to identify optimal composition

  • Membrane fluidity considerations: Test lipids with different acyl chain lengths and saturation levels to determine how membrane fluidity affects activity

  • Proteoliposome preparation method optimization: Compare detergent removal techniques (dialysis, Bio-Beads, gel filtration) for optimal protein incorporation and activity

  • Protein:lipid ratio optimization: Test multiple protein:lipid ratios (typically ranging from 1:50 to 1:500 w/w) to determine optimal reconstitution conditions

The observed enhancement of Salmonella CobS activity in liposomes suggests that the membrane environment provides more than just a structural scaffold—it likely plays a direct role in modulating enzyme function, possibly through specific lipid-protein interactions or by facilitating proper conformational changes during catalysis .

What are the kinetic parameters of CobS and how do they compare between different bacterial species?

Comprehensive kinetic analysis of CobS should determine the following parameters, which can then be compared between P. entomophila and other bacterial species like Salmonella:

ParameterMeasurementTypical Range for Salmonella CobSNotes
Km for adenosylcobinamide-GDPSubstrate concentration at half-maximal velocity0.5-5 μMMeasured in proteoliposomes
Km for α-ribazole-5'-phosphateSubstrate concentration at half-maximal velocity1-10 μMMeasured in proteoliposomes
kcatTurnover number0.1-1 min^-1For membrane enzymes, often lower than soluble enzymes
kcat/KmCatalytic efficiency10^4-10^5 M^-1s^-1Important for comparing orthologs
pH optimumActivity across pH rangepH 7.5-8.5Buffer composition may affect results
Temperature optimumActivity across temperature range30-37°CImportant for physiological relevance
Divalent cation requirementsActivity with various metal ionsMg^2+, Mn^2+Typically 5-10 mM concentration

Differences in kinetic parameters between bacterial species may reflect adaptations to different ecological niches or metabolic requirements. For example, P. entomophila, as an entomopathogenic bacterium, may have evolved kinetic properties optimized for function in insect hosts, potentially differing from those of Salmonella, which primarily infects mammals .

How do mutations in conserved domains affect CobS function and what does this reveal about its mechanism?

Structure-function analysis of CobS can provide insights into its catalytic mechanism. Based on comparative genomics and preliminary structural predictions, several key domains and residues can be targeted for mutational analysis:

  • Membrane-spanning regions: Mutations in predicted transmembrane helices can help determine their role in substrate binding, catalysis, or structural integrity

  • Nucleotide-binding motifs: Conserved residues likely involved in adenosylcobinamide-GDP recognition

  • Conserved charged residues: These often participate in catalysis or substrate binding

For each mutant, comprehensive characterization should include:

  • Protein expression and membrane localization analysis

  • Liposome reconstitution and activity assays

  • Substrate binding studies (using isothermal titration calorimetry or surface plasmon resonance adapted for membrane proteins)

  • In vivo complementation assays in ΔcobS strains

From studies with other enzymes in the cobalamin biosynthetic pathway, it's known that specific conserved residues are critical for function. For example, in CobU, a lysine residue is essential for GTP binding . Similar critical residues likely exist in CobS, and their identification would significantly advance our understanding of its catalytic mechanism.

What is the three-dimensional structure of CobS and how does it change during catalysis?

While the crystal structure of CobS remains unsolved, several approaches can be employed to elucidate its structure and conformational changes:

Structural studies would be particularly informative if conducted with CobS in different states: apo (unbound), with individual substrates, and with both substrates. This would reveal the conformational changes that occur during the catalytic cycle and provide insights into how the membrane environment influences these changes.

How does the multi-enzyme complex for B12 biosynthesis assemble on the membrane and what protein-protein interactions are involved?

The late steps of cobalamin biosynthesis likely involve a multi-enzyme complex associated with the cell membrane, including CbiB, CobU, CobT, CobC, and CobS . Understanding this complex assembly requires sophisticated approaches:

  • Co-immunoprecipitation with tagged CobS: To identify interacting partners in vivo

  • Bacterial two-hybrid or split-GFP assays: Modified for membrane proteins to confirm direct interactions

  • Microscale thermophoresis: To quantify binding affinities between purified components

  • FRET-based assays: To detect proximity between labeled proteins in proteoliposomes

  • Native mass spectrometry: Adapted for membrane protein complexes to determine stoichiometry

  • In situ cryo-electron tomography: To visualize complexes in their native membrane environment

  • Reconstitution of the entire pathway: In proteoliposomes containing all purified components to assess functional coupling

The composition and organization of this complex may differ between bacterial species, reflecting adaptations to different metabolic requirements or environmental conditions. Comparative studies between P. entomophila and Salmonella could reveal important insights into the evolution and adaptation of vitamin B12 biosynthesis machinery.

How can researchers overcome the challenges associated with CobS expression and purification?

Membrane proteins like CobS present several technical challenges that require specialized solutions:

ChallengeSolution StrategyDetails
Low expression levelsFusion tags and specialized expression systemsAddition of fusion partners like MBP (maltose binding protein) can increase solubility; C-terminal GFP fusion allows monitoring of folding during expression
Toxicity to expression hostTightly controlled expression systemsUse of titratable promoters (T7lac, tac with lac repressor, araBAD) and specialized E. coli strains (C41/C43) designed for toxic membrane proteins
Inclusion body formationOptimization of induction conditionsLower temperatures (16-20°C), reduced inducer concentrations, and slower induction rates can improve proper membrane insertion
Heterogeneous protein preparationAdvanced purification techniquesMultiple chromatography steps including ion exchange, size exclusion, and affinity chromatography; fluorescence-detection size exclusion chromatography (FSEC) to monitor protein quality
Detergent-induced instabilityDetergent screening and alternativesSystematic testing of different detergents; use of amphipols, nanodiscs, or styrene-maleic acid lipid particles (SMALPs) as detergent alternatives
Loss of activity during purificationLipid supplementationAddition of specific lipids during purification to maintain native-like environment

For Salmonella CobS, significant improvements in purification yield and homogeneity have been achieved, reaching 96% homogenous protein . Similar optimization strategies would likely benefit P. entomophila CobS purification.

What methods can be used to study substrate binding to CobS?

Given the membrane-bound nature of CobS, specialized methods are required to study substrate binding:

  • Isothermal titration calorimetry (ITC) adapted for membrane proteins: By using CobS in detergent micelles or nanodiscs, binding thermodynamics (Kd, ΔH, ΔS) can be determined

  • Microscale thermophoresis (MST): Requires less protein than ITC and is more tolerant of detergents

  • Surface plasmon resonance (SPR): With CobS immobilized on sensor chips via capture of proteoliposomes or nanodiscs

  • Fluorescence-based assays: Using either intrinsic tryptophan fluorescence or introduced fluorescent probes that respond to conformational changes upon substrate binding

  • Radiolabeled substrate binding assays: With rapid separation of bound and free substrate using filtration techniques adapted for membrane proteins

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To identify regions of altered solvent accessibility upon substrate binding

For Salmonella CobS, binding studies have contributed to understanding the reaction mechanism and substrate specificity . Similar studies with P. entomophila CobS would reveal whether substrate recognition is conserved across species or has evolved distinct features.

How can researchers establish reliable in vivo assays for CobS function?

In vivo assays provide crucial validation of biochemical findings and insights into physiological relevance. For CobS, several approaches are valuable:

  • Genetic complementation: Construction of P. entomophila ΔcobS strains complemented with wild-type or mutant cobS genes to assess functionality through:

    • Growth in minimal media requiring de novo B12 synthesis

    • Production of cobalamin measured by bioassays or chemical analysis

  • Reporter systems: Fusion of B12-dependent promoters to reporter genes (lacZ, gfp) to monitor cobalamin production in vivo

  • Metabolic labeling: Using radioactive precursors to track flux through the cobalamin biosynthetic pathway

  • Subcellular localization: Fluorescent protein fusions or immunogold electron microscopy to confirm membrane localization and potential co-localization with other pathway enzymes

  • Bacterial two-hybrid assays: Modified for membrane proteins to identify interacting partners in vivo

  • CRISPR interference (CRISPRi): For titratable repression of cobS expression to determine the relationship between CobS levels and cobalamin production

These approaches collectively provide a comprehensive view of CobS function in its native context and can reveal aspects not apparent from in vitro studies.

How conserved is CobS across bacterial species and what does this reveal about evolutionary constraints?

Comparative genomic analysis of CobS across bacterial species reveals important insights into evolutionary constraints on this enzyme:

  • Sequence conservation: Multiple sequence alignment of CobS homologs from diverse bacteria (including P. entomophila, Salmonella, and other cobalamin producers) reveals:

    • Highly conserved residues likely involved in catalysis or substrate binding

    • Variable regions that may reflect adaptation to different cellular environments

    • Conserved transmembrane topology suggesting functional constraints on membrane association

  • Phylogenetic analysis: Construction of phylogenetic trees based on CobS sequences can reveal evolutionary relationships and potential horizontal gene transfer events

  • Structural predictions: Homology modeling based on more conserved bacterial membrane proteins can predict structural conservation despite sequence divergence

  • Functional complementation experiments: Testing whether CobS from one species can complement ΔcobS mutations in another species provides insights into functional conservation

  • Genomic context analysis: Examining the organization of cob genes across species can reveal conservation or divergence in pathway organization

The universal membrane association of CobS across all cobamide producers suggests strong evolutionary constraints on this feature, likely reflecting a fundamental role of membrane association in enzyme function .

What unique features might P. entomophila CobS possess compared to other bacterial CobS enzymes?

As an entomopathogenic bacterium adapted to infect insects, P. entomophila might have evolved unique features in its CobS enzyme:

  • Temperature adaptation: Potentially optimized for function at insect body temperatures (typically 25-30°C) rather than mammalian body temperature

  • pH tolerance: Possibly adapted to function across a wider pH range reflecting variability in insect gut environments

  • Substrate specificity variations: Potential differences in recognition of lower ligand bases reflecting availability in insect hosts

  • Membrane composition adaptation: Potential preference for specific lipid environments that mirror P. entomophila membrane composition, which may differ from enteric bacteria like Salmonella

  • Protein-protein interactions: Potentially unique interactions with other components of the B12 biosynthetic pathway or with insect-specific regulatory factors

  • Stress resistance: Possible adaptations to function under oxidative stress or immune responses encountered during insect infection

Comparative biochemical studies between P. entomophila CobS and homologs from other bacteria would be required to identify and characterize these potential unique features.

How do differences in cellular physiology between Pseudomonas and other bacteria affect CobS function and regulation?

The cellular context in which CobS operates differs significantly between Pseudomonas and other bacteria like Salmonella, potentially affecting enzyme function and regulation:

  • Membrane composition differences: Pseudomonas species typically have distinct membrane lipid compositions compared to Enterobacteriaceae, which may affect:

    • CobS activity and kinetic parameters

    • Protein stability and turnover

    • Interactions with other membrane proteins

  • Metabolic network variations: Differences in central metabolism between Pseudomonas and other bacteria may affect:

    • Availability of precursors for B12 biosynthesis

    • Energy status affecting pathway regulation

    • Redox balance influencing enzyme function

  • Regulatory mechanisms: Distinct transcriptional and post-translational regulatory mechanisms may exist:

    • Different transcription factors controlling cobS expression

    • Unique metabolite-sensing mechanisms

    • Species-specific post-translational modifications

  • Subcellular organization: Potential differences in membrane domain organization:

    • Localization to specific membrane regions

    • Co-localization with other pathway enzymes

    • Protein-protein interactions specific to Pseudomonas

  • Stress response integration: How cobalamin biosynthesis integrates with stress responses may differ:

    • Oxidative stress adaptation

    • Iron limitation responses

    • Host-defense evasion mechanisms

Understanding these contextual differences requires integrative approaches combining biochemistry, genetics, and systems biology to place CobS function within the broader cellular framework of P. entomophila.

How can understanding P. entomophila CobS contribute to developing new antimicrobial strategies?

Detailed knowledge of P. entomophila CobS could contribute to antimicrobial development through several avenues:

  • Target-based inhibitor design: As a membrane protein with essential function, CobS represents a potential target for novel antibiotics. Structure-based drug design approaches could:

    • Identify small molecules that bind to conserved active sites

    • Develop peptidomimetics that disrupt protein-protein interactions in the biosynthetic complex

    • Design substrate analogs that competitively inhibit enzyme function

  • Species-selective targeting: Identifying unique features of pathogen CobS enzymes could allow development of selective inhibitors that spare beneficial microbiota

  • Pathway vulnerability analysis: Understanding rate-limiting steps and regulatory nodes in the B12 biosynthetic pathway could reveal additional targeting opportunities

  • Biocontrol applications: For entomopathogenic bacteria like P. entomophila, manipulation of CobS function could enhance or attenuate virulence for agricultural pest control applications

  • Combination therapy approaches: CobS inhibitors could potentially sensitize bacteria to existing antibiotics through metabolic perturbation

The unique membrane association of CobS provides both challenges and opportunities for inhibitor development, potentially allowing exploitation of the bacterial membrane interface as part of targeting strategies.

What novel biotechnological applications might arise from engineered variants of CobS?

Engineered CobS variants could enable several biotechnological applications:

  • Designer cobamide production: Engineered CobS enzymes with altered substrate specificity could produce novel cobamides with:

    • Modified lower ligand bases for specialized cofactor functions

    • Enhanced stability for industrial applications

    • Improved bioavailability for nutritional supplementation

  • Biosensors: CobS-based sensors could detect:

    • Metabolites that interact with the B12 biosynthetic pathway

    • Environmental conditions affecting membrane protein function

    • Substrates or products of the CobS reaction

  • Biocatalysis: Engineered CobS could potentially catalyze novel reactions:

    • Formation of artificial nucleotide loops on corrin rings

    • Coupling of alternative bases to create hybrid molecules

    • Integration into synthetic metabolic pathways

  • Membrane protein engineering platforms: Insights from CobS engineering could advance general methods for membrane protein engineering:

    • Stability enhancement strategies

    • Membrane targeting approaches

    • Activity modulation techniques

  • Cell-free production systems: Reconstituted proteoliposome systems containing engineered CobS could enable:

    • Continuous production of cobamides outside living cells

    • Integration with other enzymatic pathways

    • Controlled production of cobamide derivatives

These applications would require extensive protein engineering efforts, likely involving directed evolution approaches combined with rational design based on structural insights.

What emerging technologies might advance our understanding of CobS structure and function?

Several cutting-edge technologies hold promise for advancing our understanding of CobS:

  • Cryo-electron microscopy advances: Recent developments in cryo-EM have revolutionized membrane protein structural biology:

    • Single-particle analysis reaching near-atomic resolution

    • Time-resolved cryo-EM capturing conformational states

    • Cryo-electron tomography revealing native membrane contexts

  • Integrative structural biology approaches:

    • Combining multiple experimental techniques (cryo-EM, NMR, SAXS, mass spectrometry)

    • Computational integration of sparse experimental data

    • Molecular dynamics simulations in explicit membrane environments

  • Native mass spectrometry for membrane proteins:

    • Determining oligomeric states and complex composition

    • Identifying post-translational modifications

    • Detecting small molecule binding

  • Advanced microscopy techniques:

    • Super-resolution microscopy tracking CobS localization in living cells

    • Single-molecule FRET detecting conformational changes

    • Correlative light and electron microscopy linking function to structure

  • Artificial intelligence applications:

    • AlphaFold2 and similar tools predicting membrane protein structures

    • Machine learning approaches identifying functional patterns across homologs

    • Automated design of protein variants with desired properties

  • In-cell structural biology:

    • NMR approaches to study membrane proteins in living cells

    • Genetic code expansion incorporating spectroscopic probes

    • Proximity labeling techniques mapping interaction networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.