Recombinant Pseudomonas entomophila Disulfide bond formation protein B 1 (dsbB1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant dsbB1

The recombinant Pseudomonas entomophila disulfide bond formation protein B 1 (dsbB1) is a critical enzymatic component encoded by the dsbB1 gene (UniProt ID: Q1IEP6). This protein facilitates oxidative folding by mediating disulfide bond formation in periplasmic proteins, a process essential for bacterial viability and pathogenicity . Produced via heterologous expression in E. coli, the recombinant form includes an N-terminal His tag for purification and stability .

Role in Disulfide Bond Formation

dsbB1 belongs to the dsbB family of disulfide oxidoreductases, which regenerate active disulfide bonds in periplasmic proteins by transferring oxidizing equivalents. In Pseudomonas species, this process is vital for:

  • Protein Folding: Ensuring proper conformation of virulence factors (e.g., proteases, hemolysins) .

  • Redox Cycling: Recycling reduced DsbA proteins, which directly oxidize substrate proteins .

Homology and Functional Insights

While P. entomophila lacks a type III secretion system (T3SS), its dsbB1 shares homology with Pseudomonas aeruginosa DsbB proteins (PaDsbB1/2), which are essential for virulence . In P. aeruginosa, simultaneous deletion of dsbB genes disrupts virulence factor folding, highlighting dsbB1’s conserved role across Pseudomonas .

Entomopathogenic Relevance

P. entomophila employs diverse virulence mechanisms (e.g., insecticidal toxins, hydrogen cyanide) but relies on dsbB1 for maintaining functional secreted proteins . Mutational studies in P. entomophila have identified the GacS/GacA two-component system as a regulator of virulence, though dsbB1’s direct regulatory link remains unexplored .

Experimental Uses

ApplicationDescription
Protein Folding StudiesInvestigating oxidative folding of periplasmic proteins (e.g., elastase, lipases) .
Vaccine DevelopmentTargeting disulfide bond formation to disrupt bacterial pathogenicity .
Structural BiologyCrystallization studies to resolve dsbB1’s catalytic mechanism .

Challenges and Considerations

  • Stability: Repeated freeze-thaw cycles degrade activity; aliquoting is recommended .

  • Specificity: Functional redundancy between dsbB1 and other DsbB proteins (e.g., PaDsbB2) may complicate phenotypic analysis .

Research Gaps and Future Directions

  1. Direct Functional Studies: No studies explicitly link P. entomophila dsbB1 to virulence in Drosophila or other insects .

  2. Regulatory Networks: Exploring interactions between dsbB1 and the GacS/GacA system in pathogenicity .

  3. Therapeutic Targeting: Evaluating dsbB1 inhibitors as antimicrobial agents, building on P. aeruginosa models .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific format requirements, kindly indicate them in your order notes. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on your purchase method and location. Please consult your local distributor for specific delivery timeframes.
All protein shipments default to standard blue ice packs. If dry ice packaging is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal results, briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Recombinant Pseudomonas entomophila Disulfide bond formation protein B 1 (dsbB1) should be reconstituted with deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life can vary depending on factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
dsbB1; PSEEN0954; Disulfide bond formation protein B 1; Disulfide oxidoreductase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Pseudomonas entomophila (strain L48)
Target Names
dsbB1
Target Protein Sequence
MNELTSRLNRERRFLVLLGVICLALIGGALYMQVVLGEAPCPLCILQRYALLFIAIFAFI AAAMPGRKSLTFFEVLVVLSAIGGIVAAGNHVYILANPMVSCGIDTLQPIVDDLPLAKLW PLAFQVDGFCSTPYPPILGLSLAQWALVAFVLTTVLVPLGIYRNRRRG
Uniprot No.

Target Background

Function
Recombinant Pseudomonas entomophila Disulfide bond formation protein B 1 (dsbB1) plays a crucial role in the formation of disulfide bonds in certain periplasmic proteins. It acts by oxidizing the DsbA protein, facilitating this essential process.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How conserved is dsbB1 across Pseudomonas species, and what implications does this have for research?

The dsbB1 protein is relatively conserved across Pseudomonas species, though with some variations that may reflect adaptation to different ecological niches. When designing experiments involving dsbB1, researchers should consider:

Pseudomonas SpeciesdsbB1 ConservationPotential Research Implications
P. entomophila (L48)Reference sequenceOptimal for entomopathogen studies with Drosophila models
P. aeruginosaModerate homologyMay provide insights into virulence mechanism differences
P. putidaModerate homologyUseful for comparative studies of environmental adaptation

The conservation pattern suggests that while dsbB1 serves similar biochemical functions across species, its specific role in virulence may differ. This makes it a valuable target for comparative studies examining host-pathogen interactions across different Pseudomonas infection models .

What are the optimal conditions for expression and purification of recombinant P. entomophila dsbB1?

For optimal expression and purification of recombinant dsbB1:

  • Expression System Selection: E. coli BL21(DE3) is generally preferred for membrane protein expression. Alternative systems include CC118λpir strains for specific genetic manipulations.

  • Buffer Optimization: Use Tris-based buffer with 50% glycerol for stability. The recombinant protein should be stored at -20°C for regular use or -80°C for extended storage .

  • Purification Protocol:

    • Extract using mild detergents (e.g., n-dodecyl β-D-maltoside)

    • Employ immobilized metal affinity chromatography (IMAC)

    • Consider size exclusion chromatography as a polishing step

  • Activity Preservation: Avoid repeated freeze-thaw cycles which significantly reduce activity. Store working aliquots at 4°C for up to one week .

How can researchers evaluate the functional activity of recombinant dsbB1 in vitro?

To assess dsbB1 functional activity:

  • Enzymatic Activity Assay: Monitor the reduction of artificial electron acceptors (e.g., ubiquinone analogs) spectrophotometrically.

  • Disulfide Exchange Assay: Measure the ability to reoxidize reduced DsbA using fluorescent substrates that change properties upon disulfide formation.

  • Membrane Reconstitution: Incorporate purified dsbB1 into liposomes to assess native-like activity in a membrane environment.

  • Controls and Standards:

    Control TypePurposeExpected Result
    Heat-inactivated dsbB1Negative controlNo enzymatic activity
    E. coli DsbBPositive controlComparable activity levels
    No enzymeBaselineBackground reaction rate

When evaluating results, researchers should normalize activity to protein concentration and account for potential detergent effects on assay readings .

How can dsbB1 be used to study P. entomophila virulence in Drosophila infection models?

Researchers can leverage dsbB1 in Drosophila infection models through several approaches:

  • Gene Knockout Studies: Creating dsbB1 deletion mutants allows assessment of its role in virulence, similar to methods used for studying Monalysin toxin in P. entomophila. This approach would involve:

    • Homologous recombination using suicide vectors like pKNG101

    • Selection on appropriate media with antibiotics like streptomycin

    • Verification by PCR and sequencing

  • Comparative Virulence Assays: Compare wild-type and dsbB1-mutant P. entomophila in Drosophila infection assays, measuring:

    • Bacterial persistence in the gut (3h, 16h post-infection)

    • Host immune response activation (Diptericin expression)

    • Intestinal damage and fly survival rates

  • Protein-Protein Interaction Studies: Identify dsbB1 client proteins that may be involved in virulence factor maturation, particularly focusing on secreted toxins like Monalysin that require proper folding .

What methods are most effective for studying the role of dsbB1 in P. entomophila persistence and colonization in Drosophila?

To effectively study dsbB1's role in bacterial persistence and colonization:

  • Bacterial Load Quantification: Use protocols similar to those employed for Monalysin studies, where bacterial loads are measured at different time points (3h, 16h) post-infection to assess persistence .

  • Split-Vial Experimental Design: Implement the split-vial approach with 25 flies per vial as described in Duox and Jak/Stat signaling studies. This allows for controlled infection conditions and reliable quantification of bacterial persistence .

  • Bacterial Culture Preparation:

    • Culture P. entomophila overnight in Luria broth at 37°C with 120 rpm agitation

    • Harvest bacteria at OD600 of 0.75

    • Centrifuge for 5 minutes at 5000 rpm (4°C)

    • Resuspend in 1xPBS to achieve final infection inoculum of OD600 0.05

  • Molecular Response Analysis: Measure host immune response genes (e.g., Diptericin) using RT-qPCR, comparing responses between wild-type and dsbB1-mutant infections to assess how this protein affects host-pathogen interactions .

How might dsbB1 function interact with known virulence mechanisms in P. entomophila, particularly with the Monalysin toxin pathway?

The relationship between dsbB1 and established virulence factors like Monalysin presents an intriguing research direction:

  • Potential Regulatory Overlap: Both dsbB1 and Monalysin expression may be regulated by similar systems. Monalysin is regulated by both the GacS/GacA two-component system and the Pvf regulator . Research should examine whether dsbB1 shows similar regulatory patterns using transcriptomic approaches.

  • Functional Interaction Hypothesis: Monalysin requires N-terminal cleavage for activation and forms oligomers to create pores in membranes . As a disulfide bond formation protein, dsbB1 may be involved in:

    • Proper folding of proteases that process Monalysin

    • Direct disulfide bond formation in virulence factors

    • Maintaining redox balance in the periplasm during infection

  • Experimental Approach:

    ExperimentMethodologyExpected Outcome if Interaction Exists
    Double knockout (dsbB1/mnl)Generate mutants via homologous recombinationSynergistic attenuation of virulence
    Protein maturation analysisWestern blot for Monalysin processingAltered Monalysin processing in dsbB1 mutants
    Transcriptome analysisRNA-seq of wildtype vs. dsbB1 mutantCo-regulated gene networks identified

What role might dsbB1 play in bacterial adaptation to different stresses encountered during Drosophila infection?

The function of dsbB1 in stress adaptation during infection represents an advanced research area:

  • Oxidative Stress Response: The Drosophila gut produces reactive oxygen species via Duox enzymes as an immune defense . As a disulfide oxidoreductase, dsbB1 may:

    • Help maintain protein function under oxidative conditions

    • Participate in redox-sensing mechanisms

    • Protect bacteria from host-generated ROS

  • Experimental Design for Stress Studies:

    • Compare survival of wild-type and dsbB1 mutants under H2O2 exposure

    • Analyze transcriptome changes in response to oxidative stress

    • Measure protein carbonylation levels as indicators of oxidative damage

  • Host-Pathogen Interface: Studies could examine how dsbB1 activity changes during the different phases of infection, particularly in relation to Duox and Jak/Stat signaling that influence disease tolerance in Drosophila .

How can genome reduction approaches in Pseudomonas be used to study essential functions of dsbB1?

Genome reduction strategies provide powerful tools for dsbB1 functional analysis:

  • Minimal Genome Approaches: Using methods similar to those applied in P. aeruginosa PAO1 genome reduction, researchers can:

    • Create hypovirulent and hypersusceptible recombinant DNA hosts

    • Determine if dsbB1 is part of the core essential genome

    • Assess fitness effects of dsbB1 deletion in minimal genome backgrounds

  • Methodological Framework:

    • Employ homologous recombination using suicide vectors (e.g., pKNG101)

    • Use negative selection with sucrose on M9 plates

    • Verify deletions via PCR, sequencing, and potentially whole genome sequencing

  • Comparative Analysis: Compare findings from P. entomophila with other Pseudomonas species to identify conserved and species-specific functions of disulfide bond formation proteins in pathogenesis and environmental adaptation .

What are common challenges in working with recombinant dsbB1 and strategies to overcome them?

Researchers commonly encounter several challenges when working with recombinant dsbB1:

  • Membrane Protein Solubility Issues:

    • Challenge: Poor solubility and aggregation during purification

    • Solution: Optimize detergent selection; consider using amphipols or nanodiscs for stabilization; use fusion partners to enhance solubility

  • Storage Stability:

    • Challenge: Activity loss during storage

    • Solution: Store in Tris-based buffer with 50% glycerol; avoid repeated freeze-thaw cycles; maintain working aliquots at 4°C for up to one week

  • Functional Assay Limitations:

    • Challenge: Difficulty designing functional assays for membrane proteins

    • Solution: Use coupled enzyme systems; employ fluorescent substrates; consider reconstitution into artificial membrane systems

  • Expression System Selection:

    Expression SystemAdvantageLimitation
    E. coli BL21(DE3)High yieldPotential inclusion body formation
    E. coli CC118λpirGood for genetic manipulationLower expression yield
    P. aeruginosa expressionNative-like processingHigher biosafety level required

How should researchers interpret conflicting results between in vitro dsbB1 activity and in vivo phenotypes in Pseudomonas infection models?

When facing discrepancies between in vitro and in vivo results:

  • Physiological Context Differences: Consider that dsbB1's role in the complex environment of infection may differ from simplified in vitro systems. The protein may interact with multiple partners in vivo that aren't present in purified systems.

  • Methodological Approach:

    • Validate phenotypes using complementation studies (introducing wild-type dsbB1 to mutant strains)

    • Use point mutations in critical residues rather than complete gene deletion

    • Employ conditional expression systems to study temporal requirements

  • Regulatory Network Effects: Consider examining how regulatory systems like GacS/GacA, which control virulence factors such as Monalysin , may also influence dsbB1 expression and function.

  • Resolution Framework:

    • Map the specific conditions where discrepancies occur

    • Test intermediate models (ex vivo systems, simplified infection models)

    • Consider redundancy in biological systems (alternative pathways compensating for dsbB1 loss)

How might dsbB1 be utilized in developing novel antimicrobial strategies against Pseudomonas infections?

The potential of dsbB1 as an antimicrobial target:

  • Target Validation Approach:

    • Determine essentiality in different infection models, similar to approaches used in P. aeruginosa genome reduction studies

    • Evaluate fitness costs of dsbB1 inhibition under various environmental conditions

    • Assess conservation across clinically relevant Pseudomonas strains

  • Inhibitor Development Strategy:

    • Design high-throughput screening assays for dsbB1 inhibitors

    • Explore natural product libraries for disulfide oxidoreductase inhibitors

    • Utilize structural information to design specific inhibitors targeting catalytic residues

  • Potential Advantages as a Target:

    • Surface-accessible without crossing cytoplasmic membrane

    • Critical for virulence factor maturation

    • Relatively conserved across pathogenic Pseudomonas species

What emerging techniques could enhance our understanding of dsbB1's role in protein folding networks during infection?

Emerging methodologies for studying dsbB1 function:

  • Redox Proteomics Approaches:

    • Apply techniques to identify proteins with altered disulfide bonding patterns in dsbB1 mutants

    • Use quantitative proteomics to track changes in the secretome

    • Employ targeted redox sensors to monitor compartment-specific redox changes

  • Advanced Imaging Techniques:

    • Implement super-resolution microscopy to track dsbB1 localization during infection

    • Use FRET-based sensors to monitor disulfide exchange activity in situ

    • Employ correlative light and electron microscopy to study ultrastructural changes

  • Systems Biology Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Model the disulfide bond formation network in Pseudomonas

    • Predict infection outcomes based on dsbB1 activity levels

These future directions build upon foundational work in P. entomophila infection models and genome reduction strategies in Pseudomonas , extending them to develop a more comprehensive understanding of dsbB1's role in bacterial physiology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.