Recombinant Pseudomonas entomophila Disulfide bond formation protein B 2 (dsbB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
dsbB2; PSEEN0158; Disulfide bond formation protein B 2; Disulfide oxidoreductase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Pseudomonas entomophila (strain L48)
Target Names
dsbB2
Target Protein Sequence
MSLACLRSFFLPALLASTAVLVASFHLESVVGLVPCALCFSQRLMLGVYALVCLAALVHS PAARGRRAYAGLALASAFGGALLAGRHVWLQGDPQVVDGCHLPVEQVLQRPLGEILQMFL LGSPDCVSISWSFLDLTLPEWSLLAFLLLAAMPLSWLVAYRFRKRAMA
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It acts by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of DsbB2 in Pseudomonas entomophila?

DsbB2 in P. entomophila functions as a membrane protein that plays a critical role in the disulfide bond formation pathway. Similar to other DsbB proteins in related bacteria, P. entomophila DsbB2 is involved in the regeneration of DsbA by transferring electrons from DsbA to quinones in the membrane, thereby maintaining DsbA in an oxidized, active state . The protein contains cysteine residues that are essential for its catalytic activity in the formation of disulfide bonds in substrate proteins . The full amino acid sequence of P. entomophila DsbB2 includes critical cysteine residues, particularly in regions like "VPCA" and "CFSQRL," which are likely involved in the thiol-disulfide exchange mechanism .

What experimental systems are available for studying P. entomophila DsbB2?

Several experimental systems can be utilized for studying P. entomophila DsbB2:

  • Recombinant protein expression systems: Commercially available recombinant P. entomophila DsbB2 can be expressed with various tags for purification and functional studies .

  • Cell-based reporter systems: β-Galactosidase (β-Gal dbs) reporter systems, which are only active when disulfide bond formation is inhibited, can be adapted to study DsbB2 function. This system has been successfully used for other Dsb proteins and could be modified for P. entomophila .

  • Complementation assays: Using E. coli dsbB mutants complemented with P. entomophila dsbB2 to assess functionality through phenotypic assays such as motility tests .

  • Fluorescence-based activity assays: Monitoring the decrease in fluorescence that accompanies DsbA oxidation in the presence of DsbB and quinones .

What are the optimal methods for assessing DsbB2 activity in vitro?

For rigorous in vitro assessment of P. entomophila DsbB2 activity, researchers should consider the following methodological approaches:

Fluorescence-based kinetic assays:

  • Purify DsbB2 from membrane fractions using detergent solubilization followed by chromatography techniques

  • Monitor DsbA oxidation by tracking the 1.7-fold fluorescence decrease that occurs upon DsbA oxidation

  • Experimental conditions: 30°C, with addition of appropriate quinones as electron acceptors

  • Calculate reaction rates by measuring the initial slopes of fluorescence decrease curves

Membrane reconstitution experiments:

  • Incorporate purified DsbB2 into proteoliposomes with defined lipid compositions

  • Add reduced DsbA and monitor oxidation using AMS-based gel shift assays

  • Include appropriate quinones (ubiquinone for aerobic conditions, menaquinone for anaerobic conditions)

Redox potential measurements:

  • Determine the redox potential of the cysteine pairs in DsbB2 using equilibrium with reference redox pairs

  • Compare with values from other DsbB proteins (typically around -270 to -285 mV)

The table below summarizes key parameters for in vitro DsbB2 activity assays:

ParameterRecommended ConditionsNotes
Temperature30°COptimal for maintaining protein stability
pH7.0-7.5Physiologically relevant range
BufferTris-based with detergentFor membrane protein stability
QuinonesUbiquinone (aerobic) or menaquinone (anaerobic)Essential electron acceptors
DsbA concentration5-10 μMSubstrate for DsbB2
Detection methodFluorescence decrease or AMS gel shiftFor real-time or endpoint measurement

How can genetic manipulation techniques be applied to study DsbB2 function in P. entomophila?

To effectively study DsbB2 function through genetic manipulation, researchers should consider these methodological approaches:

Gene deletion strategies:

  • Employ SacB-based gene replacement techniques similar to those used for P. aeruginosa dsbB mutants

  • Generate single dsbB2 knockouts and dsbB1/dsbB2 double knockouts to assess functional redundancy

  • Use PCR with primers flanking the dsbB2 gene to generate upstream and downstream fragments for recombination

  • Insert antibiotic resistance cassettes (e.g., gentamicin) to select for successful recombinants

Complementation analysis:

  • Create expression vectors (e.g., pAK1900-based) containing the dsbB2 gene with its native or inducible promoter

  • Transform these vectors into dsbB2 mutant strains to assess restoration of phenotypes

  • Include appropriate controls such as empty vector and wild-type comparisons

Site-directed mutagenesis protocols:

  • Target conserved cysteine residues (particularly in the VPCA and CFSQRL motifs) using QuikChange or similar methods

  • Create variants such as C82A to assess the importance of specific residues in copper binding and catalytic function

  • Express mutant proteins with epitope tags (e.g., FLAG tag) to facilitate detection and purification

What is the relationship between DsbB2 function and P. entomophila pathogenicity toward Drosophila?

The relationship between DsbB2 function and P. entomophila pathogenicity toward Drosophila involves several interconnected mechanisms:

Virulence factor maturation:
DsbB2, along with DsbA, likely contributes to the proper folding of multiple virulence factors in P. entomophila. In related Pseudomonas species, disruption of both dsbB1 and dsbB2 significantly reduces pathogenicity due to misfolding of virulence factors . For P. entomophila specifically, the GacS/GacA two-component system regulates multiple virulence factors, including:

  • The potent pore-forming toxin Monalysin, which requires proper disulfide bond formation for its cytotoxic activity

  • Secreted proteases like AprA that help bacteria evade host immune responses

  • The cyclic lipopeptide entolysin, which contributes to bacterial motility

Experimental approaches to study this relationship include:

  • Comparative virulence assays:

    • Use Drosophila infection models with wild-type P. entomophila versus dsbB2 mutants

    • Measure survival rates and pathogen loads in flies after both oral and systemic infection

    • Assess gut damage through histological analysis and markers of epithelial integrity

  • Virulence factor secretion analysis:

    • Perform proteomic analysis of secreted proteins in wild-type versus dsbB2 mutant strains

    • Focus on known virulence factors such as Monalysin and AprA

    • Use zymography or specific enzyme activity assays to assess functional secretion of proteases

  • Host response measurements:

    • Monitor expression of antimicrobial peptides (e.g., Drosomycin, Diptericin) in flies infected with wild-type versus dsbB2 mutant P. entomophila

    • Assess ROS production and Jak/Stat pathway activation, which are critical for Drosophila tolerance to P. entomophila infection

How does copper stress influence DsbB2 expression and function in P. entomophila?

Based on studies in the related organism P. aeruginosa, copper stress likely influences DsbB2 expression and function through a specific regulatory mechanism:

Regulatory pathway components:

  • A copper-sensing two-component system (DsbRS) likely regulates dsbB2 expression under copper stress

  • The sensor kinase (DsbS) contains a copper-binding domain with a critical Cys82 residue

  • The response regulator (DsbR) binds to the promoter region of dsb genes when activated

Mechanistic model of regulation:

  • In the absence of copper, DsbS acts as a phosphatase toward DsbR, preventing activation of dsb gene expression

  • When copper is present, it binds directly to the sensor domain of DsbS, particularly at the Cys82 residue

  • Copper binding inhibits the phosphatase activity of DsbS, allowing DsbR phosphorylation and activation

  • Phosphorylated DsbR binds to the promoter regions of dsb genes, activating their transcription

Experimental approaches to study this process:

  • Construct transcriptional reporters using the dsbB2 promoter fused to fluorescent proteins or luciferase

  • Perform qRT-PCR to measure dsbB2 expression levels under varying copper concentrations

  • Use chromatin immunoprecipitation (ChIP) to assess DsbR binding to the dsbB2 promoter region

  • Create site-directed mutants in the copper-binding domain of DsbS and assess their impact on dsbB2 expression

What methodologies are most effective for studying potential redundancy between DsbB1 and DsbB2 in P. entomophila?

To effectively investigate functional redundancy between DsbB1 and DsbB2 in P. entomophila, researchers should employ multiple complementary approaches:

Genetic manipulation strategies:

  • Generate single knockout mutants (ΔdsbB1 and ΔdsbB2) and double knockout mutants (ΔdsbB1ΔdsbB2)

  • Create plasmid constructs for complementation with either dsbB1 or dsbB2 genes

  • Develop strains expressing epitope-tagged versions of both proteins for localization and expression studies

Functional redundancy assessment protocols:

  • β-Galactosidase reporter assay:

    • Express periplasmic β-Gal dbs sensor in wild-type, ΔdsbB1, ΔdsbB2, and ΔdsbB1ΔdsbB2 mutants

    • Measure β-Gal activity using both X-Gal plates and quantitative ONPG liquid assays

    • Compare results with P. aeruginosa model where functional redundancy between DsbB homologs has been observed

  • Virulence factor secretion analysis:

    • Examine secretion of known virulence factors (Monalysin, AprA, etc.) in single and double mutants

    • Use quantitative proteomics to identify the complete set of proteins affected by loss of each DsbB

  • In vitro oxidation kinetics:

    • Purify both DsbB1 and DsbB2 proteins

    • Compare their abilities to oxidize DsbA using fluorescence-based assays

    • Determine kinetic parameters (kcat, KM) for each protein with DsbA as substrate

The table below summarizes phenotypic comparisons expected between DsbB mutants:

PhenotypeWTΔdsbB1ΔdsbB2ΔdsbB1ΔdsbB2
β-Gal dbs activityLowLow/MediumLow/MediumHigh
Virulence factor secretionNormalSlightly reducedSlightly reducedSeverely reduced
DsbA oxidation stateOxidizedMostly oxidizedMostly oxidizedMostly reduced
Pathogenicity in DrosophilaHighModerateModerateLow

How can structural analysis be applied to understand the catalytic mechanism of P. entomophila DsbB2?

Structural analysis of P. entomophila DsbB2 requires sophisticated techniques to elucidate its membrane protein architecture and catalytic mechanism:

Protein preparation strategies:

  • Express recombinant DsbB2 with affinity tags in E. coli or other bacterial expression systems

  • Optimize detergent conditions for extraction from membranes (typically using mild detergents like DDM or LMNG)

  • Employ multi-step purification including affinity chromatography, ion exchange, and size exclusion

Advanced structural analysis techniques:

  • X-ray crystallography:

    • Crystallize purified DsbB2 using vapor diffusion methods with specific detergents

    • Consider lipidic cubic phase crystallization for improved membrane protein crystal formation

    • Target resolution of 2.5Å or better to visualize cysteine interactions

  • Cryo-electron microscopy (cryo-EM):

    • Prepare DsbB2 samples in appropriate detergent micelles or nanodiscs

    • Use direct electron detectors and automated data collection

    • Apply 3D reconstruction techniques with single-particle analysis

  • NMR spectroscopy for dynamics:

    • Isotopically label DsbB2 (15N, 13C) for NMR studies

    • Focus on the periplasmic loops containing catalytic cysteines

    • Analyze changes in chemical shifts upon interaction with DsbA or quinones

  • Molecular dynamics simulations:

    • Build DsbB2 models based on homology with E. coli DsbB or P. aeruginosa DsbB proteins

    • Simulate protein dynamics in membrane environments

    • Focus on thiol-disulfide exchange reactions and conformational changes

Structure-function correlation methods:

  • Site-directed mutagenesis of key residues identified from structural analysis

  • Functional assays of mutant proteins using fluorescence-based DsbA oxidation assays

  • Redox potential measurements of mutant proteins to assess changes in catalytic properties

What are common challenges when working with recombinant P. entomophila DsbB2 and how can they be addressed?

Challenge 1: Low expression yield

  • Solution: Optimize codon usage for expression host; use strong promoters (T7, tac); express as fusion with solubility-enhancing tags (MBP, SUMO)

  • Alternative approach: Try different expression hosts (E. coli C41(DE3), C43(DE3) strains designed for membrane proteins)

Challenge 2: Protein aggregation during purification

  • Solution: Screen multiple detergents (DDM, LMNG, DMNG); add stabilizing agents (glycerol 10-20%, specific lipids); maintain low temperature throughout purification

  • Alternative approach: Use native membrane environment extraction methods or nanodiscs for stabilization

Challenge 3: Loss of activity during storage

  • Solution: Store in buffer containing 50% glycerol at -20°C or -80°C; avoid repeated freeze-thaw cycles; prepare small aliquots for single use

  • Alternative approach: Maintain working aliquots at 4°C for up to one week as recommended for commercial preparations

Challenge 4: Difficulty measuring activity

  • Solution: Ensure DsbA substrate is fully reduced before assays; include appropriate quinones; optimize assay conditions (pH, salt concentration)

  • Alternative approach: Use indirect activity assays such as complementation of E. coli dsbB mutants

How can researchers distinguish between the effects of DsbB2 inhibition versus general membrane disruption in experimental systems?

When investigating DsbB2 inhibition, it's critical to distinguish specific effects from general membrane disruption:

Control experiments to include:

  • Parallel screening controls:

    • Test compounds against strains expressing different DsbB proteins (e.g., E. coli DsbB vs. P. entomophila DsbB2)

    • True DsbB2 inhibitors should show specificity rather than affecting all membrane proteins

  • Membrane integrity assays:

    • Conduct membrane permeabilization assays using fluorescent dyes (e.g., propidium iodide)

    • Measure membrane potential using voltage-sensitive dyes (e.g., DiSC3)

    • Compare results with known membrane-disrupting agents as positive controls

  • Direct binding studies:

    • Perform thermal shift assays with purified DsbB2 to detect specific binding

    • Use surface plasmon resonance or isothermal titration calorimetry to measure binding kinetics and affinity

    • Confirm direct interaction rather than general membrane effects

Experimental designs for specificity:

  • Use the β-Gal dbs reporter system in both ΔdsbB single and double mutants complemented with different DsbB proteins

  • Screen for inhibitors that affect one specific DsbB paralog but not others

  • Employ dose-response measurements to determine EC50 values that can indicate specific vs. non-specific effects

The following table provides a framework for distinguishing specific DsbB2 inhibition from general membrane disruption:

ParameterSpecific DsbB2 InhibitionGeneral Membrane Disruption
β-Gal dbs activityIncreased in DsbB2-dependent mannerIncreased indiscriminately
Membrane potentialMinimal changeSignificant depolarization
Specificity between paralogsShows preference for specific DsbBAffects all DsbB proteins similarly
Direct binding to purified proteinDetectableMinimal or non-specific
Effect on other membrane proteinsMinimalWidespread functional disruption

How might high-throughput screening approaches be designed to identify specific inhibitors of P. entomophila DsbB2?

Developing high-throughput screening (HTS) approaches for P. entomophila DsbB2 inhibitors requires careful design:

Cell-based screening platforms:

  • β-Gal dbs reporter system adaptation:

    • Express P. entomophila DsbB2 in E. coli ΔdsbB mutant carrying the β-Gal dbs reporter

    • Optimize in 384-well format using X-Gal plates or ONPG liquid assays

    • Include parallel screens with other DsbB proteins as specificity controls

  • Fluorescence-based whole-cell assays:

    • Develop reporter strains with fluorescent proteins under control of stress-response promoters activated by disulfide stress

    • Optimize for microplate reader detection in 96 or 384-well formats

    • Include appropriate positive controls (e.g., DTT as a reducing agent)

Biochemical screening approaches:

  • In vitro fluorescence-based DsbA oxidation assay:

    • Miniaturize the assay that measures fluorescence decrease upon DsbA oxidation

    • Adapt to microplate format with automated liquid handling

    • Incorporate quinones and purified DsbB2 protein

  • Redox-sensitive fluorescent protein assays:

    • Engineer redox-sensitive GFP variants that change fluorescence properties upon oxidation

    • Target these reporters to the periplasm to monitor DsbB2 activity

    • Optimize for microplate reader detection

Validation cascade for hits:

  • Primary screen using cell-based reporter systems (384-well format)

  • Secondary screening with direct biochemical assays using purified components

  • Tertiary validation with assays for membrane integrity and specificity across different DsbB proteins

  • Final validation with virulence factor secretion and pathogenicity models

What role might DsbB2 play in inter-bacterial communication and competition in microbial communities?

The potential role of DsbB2 in microbial community interactions represents an exciting frontier:

Theoretical mechanisms of interaction:

  • Environmental redox signaling:

    • DsbB2 activity affects the release of redox-active compounds into the environment

    • These compounds could influence neighboring bacteria through redox-sensitive pathways

    • The secretion of quinones or other electron shuttles might create shared redox networks

  • Competition through virulence factor regulation:

    • DsbB2 contributes to the folding and activity of secreted toxins and enzymes like Monalysin

    • These factors may provide competitive advantages in mixed-species environments

    • Proper disulfide bond formation in secreted factors may be critical for inter-species competition

Experimental approaches to investigate these roles:

  • Co-culture systems:

    • Establish defined mixed cultures of P. entomophila with other soil or insect gut bacteria

    • Compare wild-type and ΔdsbB2 mutant effects on community composition

    • Use metagenomic and metatranscriptomic analyses to assess community responses

  • Redox environment manipulation:

    • Measure extracellular redox potential in communities with and without P. entomophila DsbB2

    • Assess the impact of exogenous quinones on community dynamics

    • Investigate if DsbB2 activity affects biofilm formation in mixed communities

  • In situ studies in natural environments:

    • Examine Drosophila gut microbiome interactions with wild-type versus ΔdsbB2 P. entomophila

    • Investigate whether DsbB2 function affects colonization and persistence in competitive environments

    • Assess whether disulfide bond formation systems from neighboring bacteria can cross-complement DsbB2 deficiency

This emerging area of research connects the molecular mechanisms of protein folding to the complex dynamics of microbial communities and host-microbe interactions in natural environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.