Recombinant Pseudomonas entomophila Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudomonas entomophila Glycerol-3-Phosphate Acyltransferase (PlsY)

Recombinant Pseudomonas entomophila glycerol-3-phosphate acyltransferase (PlsY) is a bacterial enzyme critical for phospholipid biosynthesis. It catalyzes the transfer of an acyl group from acyl-phosphate to the sn-1 position of glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA)—a key precursor for membrane lipids . This enzyme is part of the PlsX/PlsY pathway, a conserved bacterial mechanism for lipid metabolism distinct from the acyl-CoA-dependent systems found in eukaryotes and some gammaproteobacteria . Recombinant PlsY is engineered with affinity tags (e.g., N-terminal His tag) for purification and functional studies, enabling research into its structure, mechanism, and potential applications .

PlsY utilizes acyl-phosphate as an acyl donor—not acyl-CoA or acyl-ACP—to produce LPA . The catalytic HxxxxD motif facilitates a charge-relay system: aspartate stabilizes histidine, which deprotonates G3P’s hydroxyl group, enabling nucleophilic attack on acyl-phosphate . This mechanism avoids reliance on acyl-CoA, making it energetically efficient under low-CoA conditions .

Functional Role in Pseudomonas entomophila

PlsY is integral to membrane biogenesis and cellular fitness:

  • Lipid Biosynthesis: Generates LPA for phospholipids, essential for cell envelope integrity .

  • Metabolic Flexibility: Operates in parallel with the PlsB pathway (acyl-CoA-dependent) in some bacteria, allowing adaptation to varying nutrient conditions .

  • Pathogenicity Links: While not directly linked to virulence factors like entolysin , PlsY’s role in membrane stability indirectly supports survival in hostile environments (e.g., insect immune systems) .

4.1. Expression and Purification

  • Host System: Expressed in Escherichia coli with N-terminal His tags for affinity chromatography .

  • Purity and Stability: >95% purity under optimized conditions, suitable for structural and kinetic assays .

ParameterSpecification
Expression VectorpET-based system (inferred)
Tag ConfigurationN-terminal His tag; potential C-terminal tag
Molecular Weight~21.5 kDa (calculated from 189aa)

4.2. Research Applications

  • Enzymatic Assays: Used to study kinetics and inhibitor screening .

  • Structural Biology: Aids in crystallography and membrane protein dynamics .

  • Biotechnological Potential: Target for antibacterial agents due to its essential role in lipid metabolism .

Research Significance and Future Directions

PlsY’s unique acyl-phosphate dependency positions it as a promising target for novel antibiotics, particularly against multidrug-resistant pathogens . Recent studies in Pseudomonas aeruginosa highlight the therapeutic potential of disrupting G3P metabolism , suggesting similar strategies could apply to P. entomophila. Further work is needed to:

  • Resolve PlsY’s 3D structure to guide drug design.

  • Explore regulatory networks (e.g., GacS/GacA two-component system) influencing PlsY expression.

  • Engineer PlsY variants for industrial lipid synthesis .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To ensure long-term stability, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by a number of factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles to preserve product integrity.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate it to us and we will prioritize development of the specified tag.
Synonyms
plsY; PSEEN0418; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Pseudomonas entomophila (strain L48)
Target Names
plsY
Target Protein Sequence
MFWSLALLAYLLGSLSFAIVLSRLTGSPDPRSSGSGNAGATNMLRLAGRKLAILTLLGDL CKGMLPVLLARQVGLDPQEQAWVGICAVLGHLFPVYFRFQGGKGVATAAGMLMALYFPAA LLAIGAWVLTFYLTRTSSLAALIATPLTLPLLAWREPEALLPMTVLTLMIVWRHRSNLRD LFAGRERHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but does not utilize acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of glycerol-3-phosphate acyltransferase (PlsY) in bacterial metabolism?

Glycerol-3-phosphate acyltransferase (PlsY) is an essential integral membrane protein that catalyzes the first step in phospholipid biosynthesis by acylating glycerol-3-phosphate (G3P). This critical step involves the transfer of an acyl group to glycerol-3-phosphate, initiating the pathway for membrane phospholipid formation . In most Gram-positive bacteria, including many pathogens, PlsY represents the only acyltransferase capable of performing this essential function, making it a potential target for antimicrobial development . The enzyme demonstrates Michaelis-Menten kinetics behavior when studied in detergent micelles, with observed Vmax values of approximately 57.5 μmol min−1 .

How does PlsY from Pseudomonas entomophila compare to similar enzymes in other bacterial species?

While the search results don't specifically compare PlsY across different Pseudomonas species, we can infer important comparative aspects based on related research. Pseudomonas entomophila is genetically related to Pseudomonas putida, with both sharing similar metabolic pathways . The essential nature of PlsY in phospholipid biosynthesis appears to be conserved across bacterial species, though structural and functional variations may exist. In Pseudomonas putida KT2440, studies have noted potential phenotypic suppression of sn-glycerol-3-phosphate acyltransferase mutants through loss of feedback inhibition mechanisms . This suggests that while the core function is preserved, regulatory mechanisms may differ between Pseudomonas species.

What expression systems are most effective for producing recombinant PlsY from Pseudomonas entomophila?

For recombinant expression of membrane proteins like PlsY, a cell-free protein synthesis system has proven effective. This approach takes the essential biological machinery required for protein production and combines them into an extract that can create enzymes synthetically, without requiring living cells as incubators . This method is particularly advantageous for membrane proteins like PlsY that may be toxic when overexpressed in living cells. For Pseudomonas genetic manipulation, researchers have successfully used homologous recombination techniques with non-replicative plasmids such as pINT for gene disruption, and vectors like pPSV35 for gene expression . These expression systems allow for controlled production of recombinant proteins while maintaining their functional properties.

What are the most efficient assay methods for measuring PlsY enzymatic activity?

Recent advances have significantly improved the efficiency of PlsY activity measurement. A high-throughput method combining microfluidics technology with cell-free protein synthesis has revolutionized enzyme analysis . This approach allows thousands of tiny experiments to run simultaneously on a single polymer chip, drastically reducing the volume of reagents required and increasing throughput.

The continuous assay method involves monitoring phosphate, one of the enzymatic products, using a fluorescently labeled phosphate binding protein . This can be conducted in two environments:

  • Lipid cubic phase (LCP) - a bilayer environment that mimics the natural membrane setting of PlsY

  • Detergent micelles - enabling compatibility with standard high-throughput liquid-handling platforms

The micelle-based approach allows researchers to conduct the assay using standard multi-channel pipets in a high-throughput manner, with optimal enzyme loading providing linear reaction velocity for up to 30 minutes .

How can I establish a reliable data table for PlsY enzyme kinetic experiments?

Creating reliable data tables for PlsY enzyme kinetics requires systematic organization of experimental variables. The following approach is recommended based on standard enzyme methodology:

  • Set up columns for independent variables (enzyme concentration, substrate concentration, pH, temperature)

  • Create separate columns for dependent variables (reaction rate in mm/sec)

  • Include multiple trials for statistical validity

  • Merge and center header cells to clearly indicate measurement units5

A typical data table structure would appear as follows:

Trial NumberEnzyme Concentration (μM)Substrate Concentration (mM)Temperature (°C)pHRate of Reaction (mm/sec)
1[value][value][value][value][value]
2[value][value][value][value][value]
..................
10[value][value][value][value][value]

For accurate data collection, ensure all numeric values are properly recorded and use clear indicators (such as "NR" for no reaction) when appropriate5. Converting all qualitative observations to quantitative measurements will facilitate subsequent statistical analysis.

What are the advantages of microfluidic approaches for studying PlsY?

Microfluidic technologies offer several significant advantages for PlsY research:

  • Miniaturization: Microfluidics shrinks the physical space needed for experiments dramatically, similar to how integrated circuits reduced the real estate needed for computing . This allows researchers to move away from traditional liter-sized flasks to nanoliter-scale reactions.

  • High-throughput capability: By engineering microscopic channels for precise fluid manipulation, researchers can conduct thousands of enzyme variant studies in parallel . Each chamber contains only a thousandth of a millionth of a liter of material, enabling massive parallelization.

  • Systematic enzyme modification: The technology allows for depositing microscopic spots of synthetic DNA coding for the enzyme onto a slide, with nanoliter-sized chambers containing protein synthesis mix aligned over these spots . This permits systematic study of how different modifications affect enzyme folding, catalytic ability, and binding properties.

  • Resource efficiency: The dramatic reduction in reagent volumes (from liters to nanoliters) makes previously prohibitive experiments economically feasible and environmentally responsible.

How does the GacS/GacA two-component system regulate gene expression of enzymes like PlsY in Pseudomonas entomophila?

The GacS/GacA two-component system plays a crucial regulatory role in Pseudomonas entomophila and potentially impacts the expression of various enzymes including those involved in phospholipid metabolism. This system functions through a complex regulatory cascade involving:

  • Two small RNAs (rsmY and rsmZ)

  • Two RNA-binding proteins (RsmA1 and RsmA2)

Research has shown that this regulatory system controls the production of various factors including the cyclic lipopeptide entolysin . While direct regulation of PlsY by GacS/GacA has not been explicitly demonstrated in the search results, this system is known to control numerous metabolic processes. The mechanism involves GacA-dependent transcription of the small RNAs (rsmY and rsmZ), which sequester the RsmA proteins, thereby preventing them from binding to target mRNAs . Deletion experiments involving rsmA1 and rsmA2 showed significant impacts on bacterial physiology, with double deletions restoring certain activities in rsmY rsmZ mutants .

What strategies can address the challenges of purifying and stabilizing recombinant PlsY for structural studies?

As an integral membrane protein, PlsY presents significant challenges for purification and structural characterization. Advanced strategies to address these challenges include:

  • Detergent micelle systems: Using optimized detergent formulations to solubilize and stabilize the membrane protein while maintaining activity . Different detergents can be systematically evaluated for their ability to preserve enzyme kinetics.

  • Lipid cubic phase (LCP) reconstitution: Incorporating the purified protein into lipid cubic phases to mimic its native membrane environment, which has been successful for activity assays and potentially for crystallization attempts .

  • Cell-free protein synthesis: This approach circumvents issues associated with toxicity and inclusion body formation often encountered during recombinant membrane protein expression in traditional systems .

  • Engineering fusion constructs: Creation of fusion proteins with soluble tags or stability-enhancing domains can improve expression and purification outcomes. This may involve translational reporter fusions similar to those described for other Pseudomonas proteins, where gene fragments are cloned into vectors like pSS231 to create in-frame fusions .

How can I apply high-throughput mutagenesis to identify critical residues in the PlsY active site?

High-throughput mutagenesis of PlsY can be effectively implemented using the microfluidic cell-free protein synthesis platform described in the research. This methodology allows for:

  • Systematic DNA modification: Using printers to deposit microscopic spots of synthetic DNA with specific mutations onto a slide .

  • Parallel protein synthesis: Aligning nanoliter-sized chambers containing protein synthesis mix over the DNA spots to produce thousands of enzyme variants simultaneously .

  • Activity screening: Incorporating fluorescence-based assays to monitor phosphate release as a measure of enzymatic activity .

  • Structure-function correlation: By systematically modifying amino acid residues and observing effects on catalytic parameters, researchers can map the functional architecture of the active site.

This approach enables the creation of comprehensive mutation libraries where each chamber tests a different protein variant, drastically accelerating the process of identifying essential residues. The methodology has been demonstrated to successfully analyze enzymatic reactions with Michaelis-Menten kinetics behavior, making it ideal for PlsY characterization .

How should I normalize PlsY activity data across different experimental conditions?

Normalizing PlsY activity data requires addressing several variables that can influence enzymatic measurements:

  • Baseline correction: Subtract no-enzyme control values from all measurements to account for background phosphate or non-specific signal.

  • Protein concentration normalization: Express activity as specific activity (μmol product/min/mg protein) to account for variations in enzyme loading across experiments.

  • Temperature and pH standardization: Either maintain consistent conditions across experiments or develop correction factors based on established temperature and pH dependence curves for the enzyme.

  • Detergent effects: If using different detergent systems, establish correction factors that account for varying effects of detergents on enzyme activity.

  • Linear range verification: Ensure all measurements are taken within the linear range of reaction velocity, which has been established as up to 30 minutes under optimal enzyme loading conditions .

When presenting normalized data, clearly indicate all normalization procedures in methodology sections and include both raw and normalized values in supplementary information to enable independent verification of results.

What statistical approaches are most appropriate for analyzing PlsY kinetic parameters?

For rigorous analysis of PlsY kinetic parameters, the following statistical approaches are recommended:

  • Non-linear regression for Michaelis-Menten kinetics: Use specialized enzyme kinetics software to fit velocity versus substrate concentration data to the Michaelis-Menten equation, extracting parameters such as Km and Vmax .

  • Linear transformations: Apply Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf plots as complementary approaches, while recognizing their limitations in weighting data points.

  • Global fitting approaches: When analyzing the effects of inhibitors or activators, utilize global fitting across multiple datasets to improve parameter estimation.

  • Bootstrap analysis: Implement bootstrap resampling to establish confidence intervals for kinetic parameters without assuming normal distribution of errors.

  • Residual analysis: Examine patterns in residuals to identify systematic deviations from models that might indicate more complex kinetic mechanisms.

When reporting parameters such as the observed Vmax of 57.5 μmol min−1 for PlsY in micelles , always include confidence intervals and goodness-of-fit statistics to enable readers to evaluate the reliability of the determined values.

How might PlsY inhibitors be developed as novel antimicrobial agents?

The development of PlsY inhibitors represents a promising frontier in antimicrobial research, particularly because PlsY is the only acyltransferase catalyzing the essential first step of phospholipid biosynthesis in many Gram-positive pathogens . Strategic approaches include:

  • Structure-based drug design: Using structural information about PlsY's active site to design molecules that competitively inhibit substrate binding.

  • High-throughput screening: Employing the microfluidic and cell-free protein synthesis platforms to rapidly screen thousands of compound candidates against recombinant PlsY .

  • Analog development: Creating substrate analogs that act as competitive inhibitors by mimicking the natural substrates (acyl-phosphate and glycerol-3-phosphate).

  • Species-selective targeting: Exploiting structural or mechanistic differences between bacterial PlsY variants to develop narrow-spectrum antimicrobials with reduced resistance development potential.

  • Combination strategies: Developing inhibitors that can be used synergistically with existing antibiotics to enhance efficacy or overcome resistance mechanisms.

The continuous enzymatic assay methodology established for PlsY, which monitors phosphate release using fluorescently labeled phosphate binding proteins , provides an ideal platform for inhibitor screening and characterization.

What is the current understanding of evolutionary relationships between PlsY enzymes across bacterial species?

While the search results don't explicitly address the evolutionary relationships between PlsY enzymes across bacterial species, we can infer some aspects based on comparative genomics principles:

  • Conservation in essential pathways: As PlsY catalyzes a critical step in phospholipid biosynthesis, its core functional domains are likely highly conserved across bacterial species, particularly within related genera like Pseudomonas.

  • Regulatory divergence: The regulatory mechanisms controlling PlsY expression may have diverged significantly, as suggested by the complex GacS/GacA two-component system in Pseudomonas entomophila involving multiple small RNAs and RNA-binding proteins .

  • Species-specific adaptations: Different bacterial species likely have adapted their PlsY enzymes to function optimally under their specific environmental niches, potentially leading to variations in kinetic parameters, substrate specificity, and regulatory responses.

Future research using comparative genomics and phylogenetic analyses would be valuable to better understand these evolutionary relationships, particularly between pathogenic and non-pathogenic Pseudomonas species, which could inform antimicrobial development strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.