Recombinant Pseudomonas entomophila Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction

The large-conductance mechanosensitive channel (MscL) from Pseudomonas entomophila is a protein that responds to mechanical forces acting on the cell membrane . MscL channels are found in bacteria, archaea, and eukaryotes and act as emergency release valves, opening in response to membrane tension to prevent cell lysis . In P. entomophila, MscL is crucial for osmoregulation and maintaining cell integrity under changing osmotic conditions .

Pseudomonas entomophila as a Model Organism

Pseudomonas entomophila is a bacterium known for its entomopathogenic properties, particularly its ability to infect and kill Drosophila melanogaster upon ingestion . It is closely related to Pseudomonas putida and is found in various environments such as soil and aquatic systems . P. entomophila produces a range of virulence factors, including degradative enzymes, toxins, and secondary metabolites, which contribute to its pathogenicity .

MscL Channel Function in P. entomophila

MscL channels in P. entomophila play a vital role in maintaining osmotic balance . When a cell experiences hypotonic shock, MscL channels open to release ions, preventing excessive turgor pressure and cell lysis . Disruption of the mscL gene in P. putida, a close relative of P. entomophila, leads to deterioration of the inner membrane under hypotonic stress, highlighting the importance of MscL in osmotic regulation .

Recombinant Production of MscL

Recombinant DNA technology allows for the production of MscL in heterologous expression systems, facilitating detailed studies of its structure and function . For instance, the phaC gene from various bacteria, including Ralstonia eutropha, Aeromonas sp., and Aeromonas hydrophila, have been introduced into Pseudomonas strains to produce polyhydroxyalkanoates (PHAs) . These recombinant strains can produce PHA copolymers from unrelated carbon sources without antibiotics, enhancing their industrial potential .

MscL as a Target for Antibacterial Compounds

MscL channels have been identified as potential targets for antibacterial compounds . Compounds like SCH-79797 and IRS-16 have been shown to activate MscL, leading to membrane permeabilization and cell death . The activation of MscL by these compounds is bacteria-specific, with low toxicity observed in animal models, suggesting that targeting MscL can increase the specificity and reduce the acquired resistance of antibacterial agents .

Molecular Mechanisms of MscL Activation

The activation of MscL by compounds like SCH-79797 involves specific binding to the channel at the interface between subunits in the cytoplasmic-membrane region . Molecular docking, mutagenesis, and studies of bacterial orthologues support this mechanism . For example, mutations at specific residues, such as the substitution of lysine with arginine at position 97 in E. coli MscL, can affect the channel's sensitivity to SCH-79797 .

MscL and Cell Disruption

Engineering the osmotic state of Pseudomonas cells by manipulating MscL activity can lead to cell disruption . Deletion of the mscL gene or overexpression of outer membrane porins can imbalance cell wall osmolarity, leading to cell damage . This approach has potential applications in biotechnology for controlled cell lysis and product release .

MscL in Biofilm Formation and Bacterial Resistance

MscL's role in bacterial physiology extends to biofilm formation and bacterial resistance . Although the specific impact of MscL on biofilm formation in P. entomophila is not well-documented, studies on other bacteria like Escherichia coli, Pseudomonas putida, and Staphylococcus epidermidis suggest that MscL may influence biofilm structure and resistance to antimicrobial agents .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; PSEEN4771; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Pseudomonas entomophila (strain L48)
Target Names
mscL
Target Protein Sequence
MGMLSEFKAFAVKGNVVDMAVGIIIGAAFGKIVSSFVGDVIMPPIGLLIGGVDFSDLAIT LKAAEGDVPAVVLAYGKFIQTILDFIIVAFAIFMGVKVINRLKREEAVAPTAPPVPSAEE TLLTEIRDLLKAQNRQP
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas entomophila and why is it significant in bacterial research?

Pseudomonas entomophila is an entomopathogenic bacterium capable of infecting and killing Drosophila melanogaster upon ingestion. Genome sequencing indicates it is a versatile soil bacterium that shares close phylogenetic relationship with Pseudomonas putida. The significance of P. entomophila stems from its unique pathogenicity mechanisms and its potential applications in biocontrol. The bacterium employs a GacS/GacA two-component regulatory system that plays a crucial role in its pathogenicity by controlling various virulence factors, including the secreted protease AprA, which helps the bacterium evade the fly's immune response . P. entomophila also produces a diffusible hemolytic agent called entolysin, a cyclic lipopeptide containing 14 amino acids and a 3-C10OH fatty acid, which contributes to its physiological properties but is not directly involved in its virulence against Drosophila . The study of this organism provides valuable insights into bacterial pathogenicity mechanisms, regulatory systems, and potential biocontrol applications.

What are mechanosensitive channels and what is their primary function in bacteria?

Mechanosensitive channels are membrane protein complexes that respond to mechanical stress in the cell membrane. The Large Conductance Mechanosensitive Channel (MscL) is constitutively expressed in microbial cells and opens in response to stretch forces in the lipid bilayer . The primary function of MscL is to act as an emergency release valve during osmotic shock. When bacteria experience hypoosmotic conditions, water rapidly enters the cell, creating tension in the cell membrane. This mechanical stress activates MscL, which opens to allow the efflux of cytoplasmic solutes, thereby reducing the osmotic pressure and preventing cell lysis . This protective mechanism is particularly important during environmental transitions, such as when bacteria encounter sudden rainfall or are released from a host into an aqueous environment. The channel's ability to rapidly respond to membrane tension makes it a critical component of bacterial survival mechanisms in fluctuating environments.

How is the structure of MscL related to its function?

The MscL protein forms a homopentameric structure, with each subunit containing two transmembrane regions . This structural arrangement is directly related to its function as a pressure-sensitive channel. The MscL gates via a bilayer mechanism that is triggered by hydrophobic mismatch between the channel protein and the lipid bilayer, as well as changes in membrane curvature and/or transbilayer pressure profile .

The structural components of MscL can be understood in terms of their functional roles:

Structural ComponentFunctional Role
Transmembrane domainsForm the channel pore and sense membrane tension
Hydrophobic constrictionCreates the gate that prevents ion flow when closed
Cytoplasmic helical bundleContributes to channel stability and may participate in gating
N-terminal domainInvolved in tension sensing and channel gating
C-terminal domainMay play a role in channel assembly and stability

The pentameric arrangement allows the channel to undergo a substantial conformational change when activated, transitioning from a tightly closed state to an open pore large enough to allow the passage of small proteins and metabolites. This structural flexibility is essential for its role in preventing cell lysis during severe osmotic downshock .

How is MscL expression regulated in bacterial cells?

MscL expression is regulated in response to environmental conditions and growth phase. During the stationary phase and under osmotic shock conditions, MscL protein is upregulated to enhance the cell's capacity to prevent lysis . This regulation ensures that bacteria have sufficient mechanosensitive channels when they are most vulnerable to osmotic stress.

In Pseudomonas species, regulatory systems like the GacS/GacA two-component system may influence MscL expression as part of the global stress response. In P. entomophila, the GacS/GacA system regulates numerous processes including the production of entolysin, and its functioning requires two small RNAs (RsmY and RsmZ) and two RsmA-like proteins (RsmA1 and RsmA2) . While the direct regulation of MscL by this system in P. entomophila has not been explicitly demonstrated in the provided search results, similar regulatory mechanisms could be involved given the importance of coordinated stress responses in bacterial physiology.

What molecular techniques are most effective for studying MscL function in Pseudomonas species?

Studying MscL function in Pseudomonas species requires a combination of genetic, biochemical, and biophysical approaches. Based on methodologies used in similar research, the following techniques are particularly effective:

  • Genetic Manipulation: Single homologous recombination can be used to create insertion mutants, as demonstrated in P. entomophila studies for other genes . For MscL research, constructing knockout mutants using suicide vectors like pK19mobsacB (which replicates in E. coli but not in Pseudomonas) would allow assessment of phenotypic changes associated with MscL deficiency .

  • Electrophysiological Methods: Patch-clamp techniques on bacterial spheroplasts or reconstituted MscL in liposomes provide direct measurements of channel activity in response to membrane tension.

  • Fluorescence Techniques: FRET (Förster Resonance Energy Transfer) can be used to monitor conformational changes in MscL proteins during gating.

  • Osmotic Shock Survival Assays: Comparing survival rates of wild-type and MscL-deficient strains during hypoosmotic shock quantifies the channel's functional importance.

The choice of technique should be guided by the specific research question, with combinations of approaches providing the most comprehensive insights into MscL function in Pseudomonas species.

How does the GacS/GacA regulatory system potentially interact with MscL expression in P. entomophila?

The GacS/GacA two-component regulatory system in P. entomophila controls multiple physiological processes and virulence factors . While direct regulation of MscL by this system has not been explicitly demonstrated in the provided literature, several potential mechanisms of interaction can be proposed based on known regulatory patterns:

  • Post-transcriptional Regulation via Small RNAs: The GacS/GacA system in P. entomophila functions through two small RNAs (RsmY and RsmZ) and two RNA-binding proteins (RsmA1 and RsmA2) . These components could potentially regulate MscL expression at the post-transcriptional level by affecting mRNA stability or translation efficiency.

  • Coordinate Regulation with Stress Responses: As MscL is upregulated during stationary phase and osmotic stress , and the GacS/GacA system regulates various stress responses, these regulatory pathways may converge to ensure appropriate MscL expression during environmental challenges.

  • Indirect Regulation via Intermediate Regulators: The GacS/GacA system controls expression of the LuxR-like regulator EtlR in P. entomophila, which in turn regulates entolysin biosynthesis . Similar hierarchical regulation might apply to MscL expression.

Experimental approaches to investigate these potential interactions could include analyzing MscL expression in GacS/GacA mutants, studying the binding of RsmA proteins to MscL mRNA, and examining MscL promoter activity under different conditions in wild-type and regulatory mutant backgrounds.

What are the key differences between MscL in P. entomophila and other bacterial species?

While specific comparative data on MscL across different bacterial species is limited in the provided search results, several potential differences can be inferred based on general principles of bacterial evolution and adaptation:

FeatureP. entomophila MscLMscL in Other Bacteria
Amino acid sequenceSpecies-specific variationsHighly conserved core functional domains
Expression regulationPotentially linked to GacS/GacA systemVarious species-specific regulatory mechanisms
Gating tension thresholdMay be adapted to P. entomophila's ecological nicheVaries depending on species' osmotic stress exposure
Associated proteinsPotentially interacts with P. entomophila-specific partnersSpecies-specific interaction partners
Functional redundancyMay complement with other mechanosensitive channelsDifferent levels of redundancy depending on species

What is the potential role of MscL in P. entomophila pathogenicity against Drosophila?

The potential role of MscL in P. entomophila pathogenicity is an intriguing research question, although direct evidence is not provided in the search results. Several hypotheses can be formulated based on our understanding of bacterial pathogenesis and mechanosensitive channel function:

  • Osmotic Adaptation during Infection: When P. entomophila transitions from the environment to the Drosophila gut, it likely encounters osmotic changes. MscL could be crucial for surviving these transitions, thereby indirectly supporting pathogenicity by maintaining bacterial viability.

  • Stress Response Coordination: MscL upregulation during stationary phase may coincide with expression of virulence factors, as both are often controlled by stress-responsive regulatory networks. The GacS/GacA system in P. entomophila, which controls virulence factors , might also influence MscL expression as part of a coordinated stress response.

  • Host Defense Evasion: Some host defense mechanisms create osmotic stress for invading bacteria. MscL could help P. entomophila withstand these defenses, similar to how the AprA protease helps it escape the fly immune response .

  • Biofilm Formation: If MscL influences membrane properties or cell adhesion, it might affect biofilm formation, which can be important for colonization and persistence in the host.

To investigate these hypotheses, researchers could compare the virulence of wild-type P. entomophila with MscL-deficient mutants in Drosophila infection models, analyze MscL expression during different stages of infection, and examine the role of MscL in response to specific host defense mechanisms.

What expression systems are optimal for producing recombinant P. entomophila MscL?

Based on successful approaches with other bacterial membrane proteins and recombinant protein production methods described in the search results, several expression systems can be recommended for producing recombinant P. entomophila MscL:

  • Modified Pseudomonas fluorescens System: The P. fluorescens ΔfleQ strain has been successfully used as a protein manufacturing factory (PMF) with reduced background protein secretion . This system might be adapted for MscL expression, particularly as it is from a related Pseudomonas genus and would provide a similar membrane environment for proper folding.

  • E. coli-based Systems: Standard E. coli expression systems (BL21, C41/C43) with specialized vectors containing regulatable promoters (T7, tac) are commonly used for membrane protein expression. For MscL, these systems would need optimization of induction conditions to prevent toxicity from membrane protein overexpression.

  • Cell-free Expression Systems: These avoid potential toxicity issues and allow direct incorporation of MscL into nanodiscs or liposomes during synthesis for functional studies.

The choice of expression system should consider several factors:

Expression SystemAdvantagesLimitationsRecommended for
P. fluorescens ΔfleQNative-like membrane environment, reduced background proteinsMore complex than E. coli systemsStructural and functional studies requiring native folding
E. coli BL21(DE3)Well-established, high yieldsPotential toxicity, inclusion body formationInitial screening, mutagenesis studies
E. coli C41/C43Designed for membrane proteinsLower yields than BL21Toxic membrane proteins
Cell-free systemsAvoids toxicity, direct incorporation into lipid environmentsHigher cost, lower yieldsDifficult-to-express variants, rapid screening

For optimal results, researchers should test multiple expression systems in parallel, with careful optimization of growth conditions, induction parameters, and protein extraction methods.

What are the recommended methods for purifying recombinant MscL for structural and functional studies?

Purifying recombinant MscL requires specialized techniques due to its membrane protein nature. Based on established membrane protein purification methods and the approaches outlined in the search results for other recombinant proteins, the following protocol is recommended:

  • Membrane Extraction:

    • Harvest cells and resuspend in buffer containing protease inhibitors

    • Disrupt cells via sonication, French press, or high-pressure homogenization

    • Remove cell debris by low-speed centrifugation

    • Isolate membrane fraction through ultracentrifugation

  • Solubilization:

    • Resuspend membrane fraction in buffer containing appropriate detergent (e.g., n-Dodecyl β-D-maltoside, Triton X-100)

    • Incubate with gentle agitation (4-16 hours at 4°C)

    • Remove insoluble material by ultracentrifugation

  • Affinity Purification:

    • Apply solubilized sample to appropriate affinity resin (e.g., Ni-NTA for His-tagged constructs)

    • Wash extensively to remove non-specifically bound proteins

    • Elute with increasing imidazole concentration (e.g., 250 mM followed by 1 M)

  • Size Exclusion Chromatography:

    • Further purify by gel filtration to separate oligomeric states and remove aggregates

    • Assess protein homogeneity by dynamic light scattering

  • Detergent Exchange or Reconstitution:

    • For structural studies: exchange into detergent suitable for crystallization or cryo-EM

    • For functional studies: reconstitute into liposomes or nanodiscs

The purification protocol should be optimized based on the specific MscL construct and downstream applications. For structural studies, emphasis should be placed on purity and homogeneity, while functional studies require retention of native activity, which can be assessed through reconstitution and osmotic shock or patch-clamp experiments.

How can researchers assess the functionality of recombinant MscL in vitro?

Assessing the functionality of recombinant MscL requires specialized techniques that measure its response to membrane tension. The following methods are recommended based on established approaches in mechanosensitive channel research:

  • Liposome Efflux Assays:

    • Reconstitute purified MscL into liposomes loaded with fluorescent dyes

    • Apply osmotic downshock or other membrane-stretching forces

    • Monitor dye release as a measure of channel opening

    • Quantify results using fluorescence spectroscopy

  • Patch-Clamp Electrophysiology:

    • Reconstitute MscL into giant unilamellar vesicles or form proteoliposome blisters

    • Apply negative pressure through patch pipette to create membrane tension

    • Record single-channel currents in response to defined pressure gradients

    • Analyze conductance, pressure threshold, and gating kinetics

  • Planar Lipid Bilayer Recordings:

    • Incorporate purified MscL into planar lipid bilayers

    • Apply lateral tension through various methods (e.g., osmotic gradient)

    • Measure channel currents in response to controlled membrane deformation

  • Stopped-Flow Spectroscopy:

    • Mix MscL-containing liposomes with hypoosmotic solution in stopped-flow apparatus

    • Monitor rapid changes in light scattering or fluorescence

    • Calculate rate constants for channel opening and closing

The data from these functional assays can be presented in the following format:

Functional ParameterMeasurement MethodExpected Range for Functional MscL
Pressure thresholdPatch-clamp5-15 mmHg (depending on lipid composition)
Single channel conductancePatch-clamp or planar bilayer2-3 nS in standard conditions
Open probability vs. tensionPatch-clampSigmoid curve with steep transition
Solute efflux rateLiposome assay>50% release within seconds of osmotic shock

These methods complement each other and provide a comprehensive assessment of MscL functionality, from single-channel properties to population behavior in membrane environments.

What genetic manipulation techniques are most suitable for studying MscL in P. entomophila?

Based on the genetic manipulation approaches described in the search results for other Pseudomonas species, the following techniques are recommended for studying MscL in P. entomophila:

  • Gene Deletion via Homologous Recombination:

    • Generate deletion constructs using SOEing PCR (Splicing by Overlap Extension)

    • Clone the deletion construct into a suicide vector like pK19mobsacB

    • Introduce into P. entomophila via conjugation or electroporation

    • Select for single crossover events using antibiotic resistance

    • Counter-select for double crossover events using sucrose sensitivity

    • Verify deletion by PCR and phenotypic analysis

  • Site-Directed Mutagenesis:

    • Design mutations in the MscL gene to alter specific residues

    • Introduce mutations using overlap extension PCR or commercial kits

    • Clone into appropriate vectors for complementation studies

    • Express mutant versions in MscL-deficient strains

  • Reporter Gene Fusions:

    • Create transcriptional or translational fusions between MscL promoter/gene and reporter genes (GFP, luciferase)

    • Integrate into the P. entomophila genome or maintain on stable plasmids

    • Monitor expression patterns under different conditions

  • Complementation Analysis:

    • Express wild-type or mutant MscL in deletion strains

    • Assess restoration of phenotypes (e.g., osmotic shock survival)

    • Use inducible promoters to control expression levels

The choice of genetic manipulation technique should align with the research question being addressed. For instance, gene deletion is appropriate for understanding MscL's role in cellular physiology, while site-directed mutagenesis is valuable for structure-function studies of specific residues or domains within the MscL protein.

Why might recombinant MscL fail to express in heterologous systems?

Membrane proteins like MscL present numerous challenges for recombinant expression. When expression attempts fail, several common issues and solutions should be considered:

  • Protein Toxicity:

    • Problem: Overexpression of MscL can disrupt membrane integrity and cell viability.

    • Solutions: Use tightly regulated inducible promoters, lower induction temperatures (16-25°C), reduce inducer concentration, or use specialized strains designed for toxic proteins.

  • Codon Usage Bias:

    • Problem: Differences in codon preference between P. entomophila and the expression host.

    • Solutions: Synthesize codon-optimized gene for the expression host or use hosts with additional tRNA genes.

  • Protein Instability or Degradation:

    • Problem: Recombinant MscL may be recognized as foreign and degraded.

    • Solutions: Add protease inhibitors, use protease-deficient strains, optimize extraction conditions, or fuse with stability-enhancing proteins.

  • Improper Membrane Insertion:

    • Problem: MscL may not correctly integrate into the membrane of the expression host.

    • Solutions: Use expression hosts with similar membrane composition to P. entomophila, co-express with chaperones, or modify the signal sequence.

The troubleshooting approach should be systematic, changing one variable at a time and documenting outcomes in a format similar to:

Expression IssueDiagnostic IndicatorsPotential SolutionsExpected Outcomes
No expressionNo band on Western blotChange vector, optimize codon usageDetectable protein on Western blot
Low expressionFaint band on Western blotLower temperature, extend induction timeStronger band on Western blot
Expression but no activityProtein present but no functionOptimize membrane environment, check foldingFunctional reconstitution
DegradationMultiple smaller bandsAdd protease inhibitors, reduce induction timeSingle band of expected size

Systematic troubleshooting with appropriate controls will help identify and resolve specific issues in recombinant MscL expression.

How can researchers minimize background protein secretion when studying MscL?

Background protein secretion can complicate the study of specific recombinant proteins like MscL. Based on the approaches described for P. fluorescens in the search results, the following strategies can help minimize this issue:

  • Use of Optimized Genetic Backgrounds:

    • Employ strains with mutations that reduce background secretion, similar to the P. fluorescens ΔfleQ strain that eliminates flagellin (FliC) secretion .

    • Consider deleting genes for major secreted proteins in P. entomophila.

  • Media and Growth Condition Optimization:

    • Test different culture media to identify conditions that minimize background secretion.

    • As demonstrated in the search results, P. fluorescens background protein secretion remained consistent across different media (LB, TB, M9) , suggesting that genetic approaches may be more effective than media optimization alone.

  • Purification Strategy Refinement:

    • Employ multi-step purification protocols that exploit unique properties of MscL.

    • For His-tagged constructs, use optimized imidazole concentrations during elution (e.g., 250 mM followed by 1 M) .

    • Consider additional purification steps such as ion exchange or size exclusion chromatography.

  • Expression System Selection:

    • Choose expression systems with naturally low levels of secreted proteins.

    • Consider using the ABC transporter-mediated protein production system demonstrated with P. fluorescens ΔfleQ, which showed improved secretion of recombinant proteins compared to other strains .

By implementing these strategies, researchers can significantly reduce background protein contamination, facilitating more accurate analysis of recombinant MscL properties and functions.

What approaches can resolve protein aggregation issues when working with MscL?

Membrane proteins like MscL are prone to aggregation during expression, purification, and storage. The following approaches can help resolve these issues:

  • Optimization of Solubilization Conditions:

    • Screen multiple detergents at various concentrations to identify optimal solubilization conditions.

    • Consider detergent mixtures or novel solubilizing agents like styrene-maleic acid copolymers.

    • Test different buffer compositions, pH values, and ionic strengths.

  • Expression Modifications:

    • Reduce expression temperature to slow protein synthesis and allow proper folding.

    • Co-express with molecular chaperones that assist membrane protein folding.

    • Use fusion partners that enhance solubility (e.g., MBP, SUMO).

  • Addition of Stabilizing Agents:

    • Include glycerol (5-10%) in all buffers to stabilize protein structure.

    • Add specific lipids that may be required for proper folding and stability.

    • Test various additives (amino acids, sugars, osmolytes) for stabilizing effects.

  • Purification Protocol Adjustments:

    • Maintain detergent concentration above the critical micelle concentration throughout purification.

    • Avoid conditions that promote aggregation (freezing/thawing, high protein concentration).

    • Use size exclusion chromatography to separate aggregates from properly folded protein.

  • Alternative Membrane Mimetics:

    • Reconstitute into nanodiscs, which provide a more native-like membrane environment.

    • Consider amphipols or SMALPs (styrene-maleic acid lipid particles) as alternatives to detergents.

These approaches should be implemented systematically, with careful monitoring of protein state using techniques such as size exclusion chromatography, dynamic light scattering, and negative-stain electron microscopy to assess the effectiveness of each intervention.

How can researchers distinguish between MscL function and other mechanosensitive channels in Pseudomonas?

Distinguishing the function of MscL from other mechanosensitive channels in Pseudomonas species requires careful experimental design. The following approaches are recommended:

By combining these approaches, researchers can build a comprehensive understanding of MscL's specific contribution to cellular mechanosensation and distinguish its function from other mechanosensitive channels in Pseudomonas entomophila. This differentiation is crucial for accurately interpreting experiments and avoiding misattribution of phenotypes to specific channels.

What are promising areas for future research on P. entomophila MscL?

Based on current knowledge and the information provided in the search results, several promising research directions for P. entomophila MscL can be identified:

  • Regulatory Network Integration:

    • Investigate potential connections between the GacS/GacA regulatory system and MscL expression .

    • Explore how small RNAs (RsmY, RsmZ) and RNA-binding proteins (RsmA1, RsmA2) might influence MscL expression at the post-transcriptional level .

    • Map the complete regulatory network controlling MscL expression in response to different environmental stresses.

  • Structural and Functional Comparisons:

    • Determine the high-resolution structure of P. entomophila MscL and compare it with MscL from model organisms.

    • Investigate whether specific adaptations in P. entomophila MscL correlate with its lifestyle as an entomopathogen.

    • Perform comparative functional analyses of MscL from different Pseudomonas species to identify species-specific properties.

  • Physiological Role Exploration:

    • Examine the role of MscL in biofilm formation and surface colonization.

    • Investigate potential connections between mechanosensation and virulence in P. entomophila.

    • Study how MscL contributes to survival in the specific environments encountered during the P. entomophila lifecycle.

  • Biotechnological Applications:

    • Explore the potential of P. entomophila MscL as a component in biosensors for detecting membrane stress.

    • Investigate whether MscL could be engineered as a controlled release mechanism for biocontrol applications.

    • Assess whether insights from P. entomophila MscL could contribute to developing new antimicrobial approaches .

These research directions build upon existing knowledge while addressing significant gaps in our understanding of MscL function in this particular bacterial species. Each direction offers opportunities for both fundamental discoveries and potential applications.

How might advances in protein expression systems improve MscL research?

Advances in protein expression systems offer significant potential to overcome current challenges in MscL research. Based on emerging technologies and approaches described in the search results, several promising developments include:

  • Engineered Pseudomonas Expression Hosts:

    • The development of P. fluorescens ΔfleQ as a protein manufacturing factory with reduced background protein secretion demonstrates the potential of engineered Pseudomonas strains .

    • Future systems could combine reduced background secretion with other optimizations specific to membrane protein expression.

    • Strains with modified membrane compositions could provide more native-like environments for MscL folding and function.

  • ABC Transporter-Mediated Secretion Systems:

    • The ABC transporter-mediated protein production system described for P. fluorescens could be adapted for MscL expression .

    • This approach could potentially improve yield and folding of challenging membrane proteins like MscL.

    • Optimization of the LARD3-mediated secretion system for membrane proteins could create new opportunities for expression and purification .

  • Cell-Free Expression Systems:

    • Advanced cell-free systems allow direct incorporation of membrane proteins into nanodiscs or liposomes during synthesis.

    • This approach bypasses challenges associated with in vivo toxicity and membrane insertion.

    • Continuous exchange cell-free systems could enable higher yields of functional MscL.

  • Synthetic Biology Approaches:

    • Designer expression hosts with minimal genomes and customized cellular machinery.

    • Orthogonal translation systems that reduce competition with host proteins.

    • Automated high-throughput screening of expression conditions to rapidly identify optimal parameters.

These advances could significantly accelerate MscL research by providing more reliable sources of properly folded, functional protein for structural and functional studies. The combination of reduced background protein secretion, improved expression yields, and more native-like membrane environments would address several current limitations in the field.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.