Recombinant Pseudomonas entomophila NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
nuoA; PSEEN3484; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Pseudomonas entomophila (strain L48)
Target Names
nuoA
Target Protein Sequence
MSDSAGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRAKNEPFESGMLPVGSARL RLSAKFYLVAMLFVIFDIEALFLYAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGA LDWAPEGRRKRQAKLKQ
Uniprot No.

Target Background

Function
NDH-1 functions as a NADH-quinone oxidoreductase, transferring electrons from NADH to quinones within the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, translocating four protons across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of NADH-quinone oxidoreductase subunit A in Pseudomonas species?

NADH-quinone oxidoreductase (also known as NADH dehydrogenase) plays a critical role in the respiratory chain of Pseudomonas species. The subunit A (nuoA) contributes to the complex I component of the electron transport chain, facilitating electron transfer from NADH to quinone. In Pseudomonas strains, NADH dehydrogenases exhibit constitutively high activity, which significantly impacts the cellular redox metabolism and energy generation . The enzyme catalyzes the oxidation of NADH to NAD+, transferring electrons to the respiratory chain while simultaneously pumping protons across the membrane, contributing to the establishment of a proton gradient used for ATP synthesis.

How does the genetic structure of nuoA in P. entomophila compare to other Pseudomonas species?

The nuoA gene in Pseudomonas entomophila shares significant homology with corresponding genes in other Pseudomonas species, such as P. putida and P. taiwanensis. In comparative genomic analyses, the nuo operon (which includes nuoA) is highly conserved across the Pseudomonas genus, though species-specific variations in regulatory elements and genetic context exist. The genetic organization typically involves the nuoA gene as part of the larger nuo operon, which encodes the multiple subunits of the NADH dehydrogenase complex. Genetic studies in related species like P. taiwanensis have demonstrated that modifications to NADH dehydrogenase genes can significantly alter the strain's metabolic profile and respiratory activity .

What experimental methods are recommended for initial characterization of recombinant nuoA expression?

For initial characterization of recombinant nuoA expression in P. entomophila, a methodical approach combining molecular biology and biochemical techniques is recommended:

  • Gene cloning and expression vector construction: The nuoA gene should be amplified from P. entomophila genomic DNA using specific primers, followed by cloning into an appropriate expression vector. Similar to approaches used with other Pseudomonas species, domestication into repository vectors like pSB1C3 and subsequent cloning into expression vectors such as pSEVAb23 or pSEVAb25 under the control of constitutive promoters like BBa_J23100 has proven effective .

  • Transformation and expression validation: After transforming the recombinant construct into the host strain, expression can be validated through:

    • RT-qPCR to confirm transcription

    • Western blotting with anti-His tag antibodies (if the recombinant protein includes a tag)

    • Enzymatic activity assays measuring NADH oxidation rates spectrophotometrically

  • Initial activity characterization: Measure NADH oxidation rates using spectrophotometric assays that monitor NADH consumption at 340 nm in the presence of appropriate quinone acceptors.

What are the optimal conditions for expressing functional recombinant nuoA in Pseudomonas expression systems?

The optimization of recombinant nuoA expression in Pseudomonas systems requires careful consideration of several key parameters:

  • Expression system selection: For homologous expression within Pseudomonas, vectors with medium-copy number origins and moderately strong promoters often yield better results than high-copy vectors with very strong promoters, which can burden cellular metabolism.

  • Growth and induction conditions:

    • Temperature: 28-30°C is typically optimal for Pseudomonas growth and protein expression

    • Media composition: MOPS medium supplemented with glucose (typically 70 mM) provides good results for controlled expression studies

    • Induction timing: For inducible promoters, induction at mid-logarithmic phase (OD600 = 0.6-0.8) often yields optimal results

  • Protein solubility enhancement:

    • Co-expression with chaperones may improve folding of membrane-associated proteins like nuoA

    • Inclusion of mild detergents during cell lysis can improve extraction of membrane-associated proteins

  • Experimental validation: Design experiments with appropriate controls following analysis of variance (ANOVA) principles to properly evaluate expression conditions2. This should include:

    • Factor identification (temperature, media composition, induction timing)

    • Level determination for each factor (at least two levels per factor)

    • Randomization of experimental runs

    • Statistical analysis of results using two-way ANOVA with replicates

How can researchers effectively apply CRISPR-Cas9 technology for nuoA modification in P. entomophila?

CRISPR-Cas9 represents a powerful tool for genetic manipulation of nuoA in P. entomophila. Based on successful applications in related Pseudomonas species, the following methodological approach is recommended:

  • Guide RNA design: Design guide RNAs targeting nuoA with high specificity and minimal off-target effects. Tools such as CHOPCHOP or Benchling can assist in identifying optimal target sites with NGG PAM sequences.

  • Vector construction: For efficient CRISPR-Cas9 editing in Pseudomonas:

    • Utilize a two-plasmid system: one carrying Cas9 and another carrying the sgRNA and homology repair template

    • For CRISPRi approaches, modified plasmids like pGCRi-2 (carrying gentamycin resistance rather than streptomycin resistance) have shown improved stability in Pseudomonas systems

  • Transformation protocol:

    • Prepare electrocompetent cells from mid-log phase cultures

    • Transform Cas9-expressing plasmid first, select transformants

    • Subsequently transform sgRNA/template plasmid

    • Use appropriate antibiotic selection strategies

  • Editing validation:

    • PCR amplification and sequencing of the target region

    • Restriction digest analysis if the edit introduces or removes a restriction site

    • Phenotypic characterization through NADH dehydrogenase activity assays

What experimental design approaches are most effective for studying nuoA function in metabolic engineering applications?

When designing experiments to investigate nuoA function in metabolic engineering contexts, a systematic approach using design of experiments (DOE) principles yields the most informative results:

  • Factor identification and experimental planning:

    • Identify key factors affecting nuoA function (expression level, environmental conditions, genetic background)

    • Apply full factorial or fractional factorial experimental designs based on the number of factors being tested

    • Include appropriate replicates to ensure statistical power2

  • Measurement parameters:

    • Primary metrics: NADH/NAD+ ratio, oxygen transfer rate (OTR), carbon dioxide transfer rate (CTR)

    • Secondary metrics: growth rate, respiration quotient (RQ), metabolite profiles

  • Data collection schedule:

    • Regular sampling throughout growth phases

    • High-resolution sampling during transition phases

    • Extended monitoring for at least 24 hours to capture complete metabolic shifts

  • Data analysis framework:

    Analysis TypeApplicationOutput Metrics
    ANOVAIdentifying significant factorsF-statistic, p-values
    Response surface methodologyOptimizing conditionsPrediction equations, contour plots
    Metabolic flux analysisQuantifying metabolic impactFlux distributions, control coefficients
  • Validation methods:

    • Construct isogenic strains differing only in nuoA status

    • Apply metabolic burden tests under various growth conditions

    • Measure respiratory activity parameters (OTR, CTR, RQ) as they provide insight into metabolic shifts

How does manipulation of nuoA expression impact the cellular redox balance and metabolic flux in P. entomophila?

The manipulation of nuoA expression has profound effects on cellular redox balance and metabolic flux distribution in Pseudomonas species:

  • NADH/NAD+ ratio perturbations:

    • Downregulation or knockout of nuoA typically increases the NADH/NAD+ ratio due to decreased NADH oxidation capacity

    • Compensatory metabolic pathways often become activated to maintain redox homeostasis

  • Respiratory chain adaptation:

    • Reduced nuoA function often triggers increased expression of alternative NADH dehydrogenases or terminal oxidases

    • The respiratory quotient (RQ) may shift from its typical value near 1.0, especially during growth on glucose where periplasmic oxidation to gluconate results in RQ values below 1.0

  • Central carbon metabolism redirection:

    • Flux through the TCA cycle often decreases to limit NADH production

    • Increased flux through NADPH-generating pathways may occur as a compensatory mechanism

    • Production of oxidized metabolites or reduced storage compounds may increase

  • Metabolic impact assessment:

    ParameterEffect of nuoA DownregulationEffect of nuoA Overexpression
    Growth rateTypically decreasedPotentially unchanged or slightly increased
    Oxygen consumptionDecreasedIncreased
    NAD+/NADH ratioDecreasedIncreased
    ATP productionInitially decreasedInitially increased
    Metabolic byproductsIncreased diversityDecreased diversity
  • Temporal adaptation patterns:
    Pseudomonas species exhibit remarkable metabolic flexibility, often developing compensatory mechanisms over time. Short-term effects of nuoA manipulation may differ significantly from long-term adaptations, necessitating time-course studies to fully characterize the metabolic response.

What approaches are most effective for integrating nuoA modification with other genetic interventions for metabolic engineering purposes?

Effective integration of nuoA modifications with other genetic interventions requires a carefully orchestrated approach:

  • Sequential vs. simultaneous modifications:

    • When combining nuoA manipulation with other metabolic engineering targets, sequential modifications with phenotypic characterization at each step often yields more stable strains

    • Simultaneous modifications can accelerate development but may create unpredictable phenotypes requiring extensive screening

  • RBS optimization strategies:

    • For fine-tuning nuoA expression, ribosome binding site (RBS) engineering has proven effective in related contexts

    • Computational tools for RBS design followed by experimental validation using biosensor systems can rapidly identify optimal expression levels

  • Layered optimization approach:

    • First layer: Optimize chassis selection and central metabolism

    • Second layer: Fine-tune enzyme complexes like NADH dehydrogenase through RBS engineering

    • Third layer: Integrate production pathways with optimized expression levels

  • Experimental validation with biosensors:

    • Implement NADH-responsive biosensors to monitor redox status in real-time

    • High-throughput screening using fluorescence-activated cell sorting (FACS) can rapidly identify beneficial genetic combinations

  • Integration with complementary technologies:

    • Combine nuoA modifications with CRISPR-based transcriptional regulation

    • Apply Cre-mediated high-throughput gene integration systems for rapid strain development

    • Utilize marker-less gene integration techniques through homologous recombination using suicide vectors like pGNW

How can researchers accurately evaluate the impact of nuoA modifications on oxidative stress responses in P. entomophila?

Evaluating the impact of nuoA modifications on oxidative stress responses requires a comprehensive analytical approach:

  • Oxidative stress biomarkers assessment:

    • Measure intracellular reactive oxygen species (ROS) levels using fluorescent probes

    • Quantify oxidative damage to lipids (lipid peroxidation), proteins (carbonylation), and DNA (8-oxoguanine formation)

    • Monitor expression levels of oxidative stress response genes (e.g., catalase, superoxide dismutase, peroxiredoxins)

  • Stress challenge experiments:

    • Subject wild-type and modified strains to controlled oxidative stress (H₂O₂, paraquat)

    • Assess survival rates and recovery kinetics

    • Analyze transcriptional responses using RNA-seq or targeted qPCR

    ParameterMeasurement MethodExpected Response in nuoA-Deficient Strains
    Survival rate under H₂O₂ stressCFU counting after exposurePotentially decreased
    Catalase activitySpectrophotometric H₂O₂ decomposition assayTypically increased
    SOD expressionWestern blot or qPCRUsually upregulated
    Protein carbonylationDNPH derivatization and immunodetectionOften increased
  • Respiratory activity characterization:

    • Measure oxygen transfer rate (OTR) and carbon dioxide transfer rate (CTR) in different growth phases

    • Calculate respiratory quotient (RQ) as CTR/OTR, with values below 1 indicating oxidation of glucose to gluconate in the periplasm

    • Compare respiratory parameters between wild-type and modified strains under different growth conditions

  • Metabolic flexibility assessment:

    • Challenge strains with sudden changes in carbon source or oxygen availability

    • Monitor metabolic adaptation through real-time measurements of respiration parameters

    • Analyze metabolite profiles during adaptation phases

What are the most common challenges in achieving stable expression of recombinant nuoA and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant nuoA expression in Pseudomonas systems:

  • Protein misfolding and inclusion body formation:

    • Challenge: As a membrane-associated protein, nuoA can misfold and form inclusion bodies

    • Solution: Optimize expression temperature (lowering to 16-20°C), use solubility tags (MBP, SUMO), and co-express with chaperones

  • Plasmid instability:

    • Challenge: Expression vectors can be unstable in Pseudomonas without constant selection pressure

    • Solution: Utilize chromosomal integration methods like I-SceI-mediated recombination or CRISPR-Cas9 counterselection

  • Antibiotic resistance issues:

    • Challenge: Pseudomonas species frequently develop resistance to certain antibiotics

    • Solution: Use alternative selection markers; for instance, replacing streptomycin with gentamycin resistance has proven effective in CRISPRi applications

  • Protein activity assessment difficulties:

    • Challenge: Measuring nuoA activity specifically within the NADH dehydrogenase complex can be difficult

    • Solution: Develop NADH dehydrogenase activity assays in membrane fractions rather than purified proteins, and use specific inhibitors to distinguish between different NADH dehydrogenases

  • Metabolic burden of expression:

    • Challenge: High-level expression can cause metabolic burden

    • Solution: Fine-tune expression through RBS engineering and promoter selection, using computational tools followed by biosensor-based experimental validation

How should researchers interpret and troubleshoot unexpected data when analyzing nuoA mutant phenotypes?

When researchers encounter unexpected results while analyzing nuoA mutant phenotypes, a structured troubleshooting approach is recommended:

  • Data validation first approach:

    • Verify experimental procedures and repeat key measurements

    • Confirm genetic modifications through sequencing and expression analysis

    • Apply statistical tests to determine if unexpected results are statistically significant

  • Genetic compensation mechanisms:

    • Check for upregulation of alternative NADH dehydrogenases

    • Assess activation of stress response pathways

    • Consider genomic adaptations through whole genome sequencing of adapted strains

  • Methodological consideration matrix:

    Unexpected ObservationPotential CauseVerification Method
    No growth defect in nuoA mutantAlternative NADH dehydrogenase compensationTranscriptomic analysis of alternative dehydrogenases
    Increased oxidative stress despite reduced respiratory activityAltered electron flow leading to increased ROSMeasure ROS levels with specific probes
    Unexpected metabolite profilesMetabolic rerouting to maintain redox balance13C metabolic flux analysis
    Variable phenotypes between replicatesPopulation heterogeneity or unstable genotypeSingle-colony isolation and recharacterization
  • Growth condition dependencies:

    • Test multiple carbon sources to reveal condition-specific phenotypes

    • Vary oxygen availability to assess respiratory flexibility

    • Consider complex media vs. defined media effects on phenotype manifestation

  • Experimental design reassessment:

    • Apply design of experiments (DOE) principles to systematically explore factor interactions

    • Use two-way ANOVA with replicates to properly analyze complex experimental designs2

    • Consider full-factorial versus fractional factorial experimental approaches based on the number of variables being tested2

What are the best practices for preparing NIH grant applications focused on nuoA research in Pseudomonas species?

When preparing NIH grant applications focused on nuoA research in Pseudomonas species, researchers should adhere to the following best practices:

  • Data table preparation:

    • Follow current NIH Training Table formats as specified for predoctoral programs

    • Combine Tables 1-6 & 8 for new applications or Tables 1-8 for renewal applications into a single document

    • Upload to "Section 9: Data Tables" of the PHS 398 Research Training Program Plan Forms I

  • Structural components for effective proposals:

    • Clear delineation between basic vs. translational aspects of nuoA research

    • Strong preliminary data showcasing expertise with Pseudomonas genetic manipulation

    • Well-defined experimental approach with appropriate controls and statistical analyses

  • Table requirements overview:

    Table #TitleInclusion Requirements
    Table 1Census of Participating DepartmentsInclude all columns except last 2 for new applications
    Table 2Participating Faculty MembersRequired for all applications
    Table 4Active Research SupportDetail all funding sources for nuoA research
    Table 6ATraining Program CharacteristicsMust be included for due dates on/after May 25, 2025
  • Timeline and milestone presentation:

    • Provide Gantt charts with clear milestones for nuoA research progression

    • Include decision points where approaches may be modified based on results

    • Specify publication and dissemination timepoints

  • Integration with broader research impacts:

    • Connect nuoA research to broader applications in metabolic engineering

    • Highlight potential applications in bioproduction of valuable compounds

    • Emphasize the fundamental biological questions being addressed alongside applied aspects

How might systems biology approaches enhance our understanding of nuoA function in the broader context of Pseudomonas metabolism?

Systems biology approaches offer powerful frameworks for comprehensively understanding nuoA function within the complex metabolic network of Pseudomonas:

  • Multi-omics integration strategies:

    • Combine transcriptomics, proteomics, and metabolomics data from nuoA-modified strains

    • Apply network analysis to identify key regulatory nodes affected by nuoA manipulation

    • Develop predictive models of metabolic adaptation to respiratory chain perturbations

  • Genome-scale metabolic modeling:

    • Incorporate nuoA and respiratory chain components into constraint-based metabolic models

    • Perform in silico simulations of various nuoA modification scenarios

    • Validate model predictions with experimental data to refine understanding of system behavior

  • Comparative systems analysis across Pseudomonas species:

    • Analyze the conservation and divergence of respiratory chain regulation

    • Identify species-specific differences in metabolic responses to nuoA modification

    • Leverage natural variation to uncover novel regulatory mechanisms

  • Temporal dynamics analysis:

    • Implement time-resolved multi-omics to capture adaptive responses

    • Develop dynamic models that account for regulatory network rewiring

    • Characterize the sequence of compensatory mechanisms activated following nuoA perturbation

  • Integration with phenotypic data:

    • Connect molecular-level changes to observable phenotypes

    • Develop predictive frameworks relating genotype to phenotype

    • Identify emergent properties not predictable from individual component analysis

What emerging genetic tools and technologies show promise for advancing nuoA research in Pseudomonas entomophila?

Several cutting-edge technologies are poised to revolutionize nuoA research in Pseudomonas entomophila:

  • Advanced genome editing technologies:

    • CRISPR-based base editors for precise nucleotide modifications without double-strand breaks

    • Prime editing systems for specific insertions, deletions, and substitutions

    • Multiplexed genome editing for simultaneous modification of nuoA and related genes

  • Biosensor development:

    • NADH/NAD+ ratio-responsive transcriptional regulators coupled to fluorescent reporters

    • Redox-sensitive protein domains for real-time monitoring of cellular redox state

    • Enzyme-coupled biosensors for specific metabolite detection

  • Single-cell analysis technologies:

    • Single-cell RNA-seq to capture population heterogeneity in response to nuoA modification

    • Time-lapse microscopy with fluorescent reporters to track individual cell responses

    • Microfluidic systems for controlled perturbation and observation of single cells

  • Synthetic biology frameworks:

    • Modular assembly of respiratory chain components with standardized interfaces

    • Orthogonal expression systems for precise control of nuoA and related genes

    • Synthetic regulatory circuits for dynamic control of respiratory chain activity

  • High-throughput phenotyping platforms:

    • Automated cultivation systems with integrated sensors for real-time monitoring

    • Microdroplet encapsulation for massively parallel strain evaluation

    • Machine learning algorithms for phenotype prediction and experimental design optimization

How can nuoA research contribute to the development of Pseudomonas as a platform for sustainable bioproduction?

Research on nuoA and NADH dehydrogenase function has significant implications for developing Pseudomonas as a sustainable bioproduction platform:

  • Redox cofactor engineering:

    • Modulation of nuoA expression can increase NADH availability for reductive biosynthetic pathways

    • Controlled partitioning of electrons between respiratory and biosynthetic processes

    • Tailored redox cofactor ratios for specific bioproduction applications

  • Metabolic flux optimization:

    • Strategic manipulation of respiratory chain components to redirect carbon flux toward desired products

    • Development of strains with enhanced ATP efficiency for improved bioproduction economics

    • Creation of strains with optimized P/O ratios (ATP produced per oxygen consumed)

  • Applications in valuable compound production:

    • Enhanced polyketide synthesis through increased malonyl-CoA availability

    • Improved production of phloroglucinol and other reduced products

    • Targeted optimization of strains for specific product classes

  • Stress tolerance enhancement:

    • Engineering respiratory chain components to improve robustness under industrial conditions

    • Development of strains with enhanced oxidative stress tolerance

    • Creation of production hosts capable of maintaining redox homeostasis during high-flux production

  • Industrial relevance metrics:

    Application AreaBenefit of nuoA ResearchPotential Impact
    Polyketide productionIncreased malonyl-CoA availabilityUp to 5.8-fold enhancement in production titers
    BioremediationImproved oxidative stress toleranceEnhanced survival in contaminated environments
    BiocatalysisControlled NADH availabilityMore efficient redox biotransformations
    Biomass conversionOptimized respiratory efficiencyReduced oxygen requirements for fermentation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.