Recombinant Pseudomonas entomophila NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Production and Purification

This recombinant protein is expressed in Escherichia coli and purified using affinity chromatography . Specifications include:

ParameterDetails
Expression HostE. coli
Purity>90% (verified by SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water with glycerol (5–50%)

Functional Role in Bacterial Respiration

The nuoK subunit is integral to the NADH dehydrogenase complex (Complex I), which:

  • Transfers electrons from NADH to ubiquinone, generating a proton gradient for ATP synthesis .

  • Supports Pseudomonas metabolic versatility under diverse environmental conditions .

Key Research Findings:

  • Regulation by Hfq: In Pseudomonas, the global RNA chaperone Hfq suppresses nuoK expression, linking respiratory efficiency to stress adaptation .

  • Energy Conservation: Strains lacking alternative NADH dehydrogenases (e.g., NQR, NDH2) rely solely on NUO for growth, highlighting its essential role in energy metabolism .

Comparative Analysis Across Pseudomonas Species

The nuoK subunit is conserved in Pseudomonas but exhibits species-specific variations:

SpeciesUniProt IDExpression SystemKey Differences
P. entomophilaQ1I7Z1E. coliFull-length (1–102 aa), His-tagged
P. putidaA5W183E. coli102-aa sequence with 94% identity
P. fluorescensA1ADC7YeastPartial sequence; lower purity (85%)

Applications in Research

This recombinant protein is primarily used to:

  • Study bacterial electron transport chain mechanics.

  • Develop inhibitors targeting NADH dehydrogenase in pathogenic Pseudomonas .

  • Serve as an antigen in immunoassays (e.g., ELISA) .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; PSEEN3493; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Pseudomonas entomophila (strain L48)
Target Names
nuoK
Target Protein Sequence
MGAIPLEHGLAVAGILFCLGLVGLMVRRNILFVLMSLEVMMNASALAFIVAGARWVQPDG QVMFILVISLAAAEASIGLAILLQLYRRFHTLDIDAASEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this particular species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. This process couples the redox reaction to proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thus conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the NADH-quinone oxidoreductase subunit K (nuoK) in Pseudomonas entomophila?

NADH-quinone oxidoreductase subunit K (nuoK) is a critical component of the NUO complex in Pseudomonas entomophila. The NUO complex is one of three NADH dehydrogenases involved in respiratory chains in Pseudomonas species (alongside NQR and NDH2). The nuoK subunit contributes to the electron transfer machinery that oxidizes NADH and passes electrons to the quinone pool. This complex couples this electron transfer to ion translocation across the cell membrane, contributing to energy conservation and an electrochemical membrane gradient . In P. entomophila specifically, this respiratory function supports its unique entomopathogenic capabilities and its broader metabolic adaptability.

How does the nuoK subunit differ between P. entomophila and other Pseudomonas species?

While the general structure and function of the nuoK subunit are conserved across Pseudomonas species, P. entomophila contains specific variations that may contribute to its unique entomopathogenic properties. Unlike P. aeruginosa, which is an opportunistic human pathogen, P. entomophila specifically targets insects . This difference in host range suggests potential structural or regulatory distinctions in respiratory chain components, including nuoK.

Comparative analysis reveals that P. aeruginosa relies on three NADH dehydrogenases (NUO, NQR, and NDH2) that contribute to total activity in the order NQR > NDH2 > NUO during exponential growth . A similar hierarchical arrangement may exist in P. entomophila, though likely with different proportional contributions reflecting its distinct ecological niche as an insect pathogen rather than a human pathogen.

What are the recommended protocols for expressing recombinant P. entomophila nuoK in laboratory conditions?

For successful expression of recombinant P. entomophila nuoK, researchers should consider the following protocol:

  • Vector Selection: Choose expression vectors compatible with Pseudomonas or E. coli systems, depending on experimental requirements. For structural studies, consider vectors with His-tag or other purification tags.

  • Expression Conditions: Optimize expression using the following parameters:

    • Temperature: 28°C (matching P. entomophila's natural growth temperature)

    • Media: LB or minimal media with appropriate antibiotics

    • Induction: IPTG concentration typically between 0.1-1.0 mM

    • Duration: 4-6 hours post-induction for E. coli systems; 12-16 hours for Pseudomonas systems

  • Membrane Protein Considerations: As nuoK is a membrane-associated protein, inclusion of membrane-solubilizing agents during purification is essential. Consider detergents such as DDM (n-Dodecyl β-D-maltoside) or LDAO (lauryldimethylamine oxide) for extraction.

  • Verification: Confirm expression using Western blotting with antibodies against the purification tag or nuoK-specific antibodies if available .

What purification methods yield the highest activity for recombinant P. entomophila nuoK?

When purifying recombinant P. entomophila nuoK, researchers should implement a multi-step approach to maintain functional integrity:

  • Initial Extraction: Carefully isolate membrane fractions using ultracentrifugation (typically 100,000 × g for 1 hour) following cell lysis.

  • Solubilization: Use mild detergents at critical micelle concentrations to solubilize the membrane proteins without denaturing the nuoK subunit.

  • Chromatography Sequence:

    • Affinity chromatography (if tagged)

    • Ion exchange chromatography

    • Size exclusion chromatography

  • Activity Preservation: Maintain 10-15% glycerol in all buffers and keep samples at 4°C throughout the purification process.

The table below summarizes recommended detergent conditions for optimal nuoK extraction:

DetergentWorking ConcentrationAdvantagesLimitations
DDM0.5-1.0%Good for complex integrityLarge micelles
LDAO0.05-0.1%Excellent for crystallographyPotentially destabilizing
Digitonin0.5%Preserves supercomplexesExpensive, variable purity
C12E80.5%High extraction efficiencyLimited stability over time

How can researchers effectively measure nuoK activity in recombinant systems?

Activity measurement of recombinant nuoK requires considering its role within the larger NUO complex. Recommended approaches include:

  • NADH Oxidation Assays: Monitor the decrease in NADH absorbance at 340 nm in the presence of suitable electron acceptors (ubiquinone or analogues). Standard reaction conditions include:

    • 50 mM phosphate buffer (pH 7.5)

    • 100 μM NADH

    • 100 μM ubiquinone-1 or decylubiquinone

    • 5-20 μg purified protein or membrane preparations

  • Proton Pumping Assays: Measure the electrochemical gradient formation using pH-sensitive fluorescent dyes (ACMA or pyranine) in reconstituted proteoliposomes.

  • Membrane Potential Measurements: Utilize potentiometric dyes such as DiSC3(5) to assess the contribution of nuoK to membrane potential generation.

  • Oxygen Consumption: Employ Clark-type oxygen electrodes to measure respiratory activity with appropriate substrates.

What are the expected phenotypic effects when nuoK is mutated or deleted in P. entomophila?

Based on studies of NADH dehydrogenases in related Pseudomonas species, researchers can anticipate several phenotypic effects when nuoK is mutated or deleted:

  • Growth Characteristics: Possible extended lag phase similar to that observed in P. aeruginosa strains with only NUO (ΔnqrFΔndh) . Consider monitoring growth curves in both rich and minimal media under various conditions.

  • Virulence Alterations: Potential changes in pathogenicity toward insect hosts. Given that P. entomophila is entomopathogenic, nuoK mutations might affect:

    • Insect mortality rates

    • Gut epithelium destruction capability

    • Systemic immune response activation in hosts

  • Metabolic Shift: Possible compensation through alternate respiratory pathways or fermentative metabolism.

  • Stress Response: Altered resistance to oxidative stress or antibiotic susceptibility.

When designing mutation studies, consider using the infection model system with Galleria mellonella larvae, which has been established for P. entomophila virulence studies .

How can nuoK be utilized as a target for developing novel biocontrol strategies against insect pests?

The nuoK subunit of P. entomophila presents a promising target for biocontrol applications due to its role in bacterial energy metabolism and potential contribution to virulence:

  • Strain Engineering Approaches:

    • Develop P. entomophila strains with modified nuoK to enhance entomopathogenic properties

    • Create metabolically balanced strains that maintain virulence while optimizing production yields

  • Selective Inhibition Strategies:

    • Design inhibitors targeting insect-pathogen specific features of nuoK

    • Develop compounds that enhance nuoK activity to increase bacterial virulence specifically against target pests

  • Host Range Considerations:

    • Given that P. entomophila has been shown to kill insects from at least three different orders , nuoK-focused biocontrol strategies could potentially target multiple pest species

    • Map the relationship between nuoK variants and host range specificity

  • Delivery Systems:

    • Formulate application methods that preserve bacterial viability

    • Design conditional activation systems tied to insect gut conditions

This approach leverages P. entomophila's natural entomopathogenic properties while potentially avoiding harmful effects on beneficial insects through precise targeting.

What interactions exist between nuoK and the host immune response during P. entomophila infection?

The interactions between P. entomophila nuoK and host immune responses represent a complex relationship that researchers should investigate through multiple approaches:

  • Immune Recognition Patterns:

    • Determine whether nuoK or its metabolic products serve as pathogen-associated molecular patterns (PAMPs)

    • Investigate if altered respiratory function affects recognition by host immune surveillance

  • Modulation of Host Defense:

    • Examine how energy metabolism through nuoK influences the production of virulence factors that may suppress host immunity

    • Test whether nuoK activity affects the bacterial response to antimicrobial peptides produced by the host

  • Experimental Models:

    • Utilize the established Galleria mellonella model, which has demonstrated immune priming responses to P. entomophila

    • Compare immune parameters (antimicrobial peptide production, hemocyte responses) between wild-type and nuoK-mutant bacterial challenges

  • Immune Evasion Strategies:

    • Investigate whether respiratory adaptation through nuoK allows the bacterium to survive within immune cells

    • Examine whether energy provided by nuoK enables production of compounds that neutralize host defenses

Studies have shown that G. mellonella larvae pre-exposed to P. entomophila develop enhanced immune responses upon secondary infection , suggesting complex interactions between bacterial factors and host immunity that may involve respiratory chain components.

How should researchers address contradictory data when studying nuoK function in P. entomophila?

When encountering contradictory data in nuoK research, follow this systematic approach:

  • Validate Experimental Setup:

    • Verify strain identity through molecular confirmation

    • Check for contamination in bacterial cultures

    • Ensure proper controls are included in all experiments

  • Examine Methodological Variables:

    • Assess how different growth conditions affect nuoK expression and function

    • Consider the impact of media composition on respiratory chain utilization

    • Evaluate whether the method of protein extraction preserves native conformation

  • Analyze Alternative Explanations:

    • Consider functional redundancy among respiratory chain components

    • Investigate possible compensatory upregulation of alternative NADH dehydrogenases (NQR, NDH2)

    • Evaluate post-translational modifications that might alter protein function

  • Implement Additional Controls:

    • Conduct complementation studies to verify phenotype attribution

    • Perform time-course experiments to capture dynamic changes

    • Include related Pseudomonas species for comparative analysis

Remember that contradictory data often leads to new discoveries. For example, research on P. aeruginosa NADH dehydrogenases revealed unexpected connections between respiratory chain components and virulence factor production .

What strategies can overcome the challenges of nuoK's membrane-associated nature in structural studies?

The membrane-associated nature of nuoK presents significant challenges for structural characterization. Researchers can employ the following strategies:

  • Detergent Optimization:

    • Screen multiple detergents systematically to identify optimal solubilization conditions

    • Consider using nanodiscs or amphipols for maintaining stability in a membrane-like environment

  • Fusion Protein Approaches:

    • Engineer constructs with stabilizing fusion partners (e.g., T4 lysozyme, BRIL)

    • Use green fluorescent protein fusions to monitor expression and folding

  • Crystallization Techniques:

    • Implement lipidic cubic phase (LCP) crystallization methods

    • Consider antibody fragment co-crystallization to provide additional crystal contacts

  • Alternative Structural Methods:

    • Utilize cryo-electron microscopy for entire NUO complex visualization

    • Apply hydrogen-deuterium exchange mass spectrometry to probe dynamic regions

    • Consider solid-state NMR for specific structural questions

The table below outlines comparative advantages of different structural biology approaches for nuoK:

MethodResolution PotentialSample RequirementsAdvantagesLimitations
X-ray CrystallographyAtomic (≤2Å)Diffracting crystalsHighest resolutionDifficult crystallization
Cryo-EMNear-atomic (2-4Å)Purified protein (≥150kDa)Visualizes entire complexSize limitations for smaller components
NMRAtomic for domainsIsotope-labeled proteinDynamic informationSize limitations
HDX-MSPeptide levelPurified proteinConformational changesLower resolution

How does nuoK function differ between P. entomophila and other bacterial pathogens?

The function of nuoK shows important distinctions between P. entomophila and other bacterial pathogens:

What are the molecular mechanisms by which nuoK contributes to P. entomophila virulence in insect hosts?

The molecular mechanisms connecting nuoK function to P. entomophila virulence likely involve several interconnected pathways:

  • Energy Provision for Virulence Factor Production:

    • nuoK-containing NUO complex generates proton motive force necessary for ATP synthesis

    • This energy supports the production of virulence factors that damage the insect gut epithelium

    • Similar to P. aeruginosa, where respiratory chain components influence the production of virulence factors like pyocyanin

  • Metabolic Adaptation to Host Environment:

    • nuoK function may enable adaptation to changing nutrient availability during infection

    • Efficient energy harvesting supports bacterial persistence and proliferation within the insect host

  • Resistance to Host Defense Mechanisms:

    • Energy from respiratory chains potentially powers efflux systems that protect against antimicrobial peptides

    • P. entomophila encounters specific immune defenses in insects, as demonstrated in the G. mellonella model

  • Signaling Integration:

    • Respiratory status sensed through nuoK activity may influence regulatory systems controlling virulence gene expression

    • Changes in membrane potential or proton gradient can serve as signals for virulence regulation

Understanding these mechanisms requires combining approaches from biochemistry, molecular microbiology, and insect immunology, particularly using model systems like G. mellonella that demonstrate specific immune responses to P. entomophila .

What emerging technologies could advance our understanding of nuoK structure-function relationships?

Several cutting-edge technologies hold promise for deepening our understanding of nuoK:

  • Cryo-Electron Tomography:

    • Visualize nuoK in its native membrane environment

    • Map interactions with other respiratory chain components at near-atomic resolution

  • Single-Molecule Biophysics:

    • Apply techniques like FRET to monitor conformational changes during electron transfer

    • Use optical tweezers to measure mechanical forces during proton pumping

  • Computational Approaches:

    • Implement molecular dynamics simulations to model proton translocation

    • Use machine learning to predict structure-function relationships from sequence data

  • Advanced Genetic Tools:

    • Apply CRISPR-Cas systems for precise genome editing in P. entomophila

    • Develop conditional expression systems to study essential functions

  • Synthetic Biology:

    • Create minimal respiratory chain modules to define essential components

    • Engineer chimeric systems combining elements from different species to identify species-specific functions

How might understanding nuoK contribute to broader research on bacterial adaptation and evolution?

Research on P. entomophila nuoK offers valuable insights into broader evolutionary processes:

  • Ecological Specialization:

    • Investigate how respiratory chain adaptations contribute to P. entomophila's specialized entomopathogenic lifestyle

    • Compare with related Pseudomonas species to identify niche-specific adaptations

  • Metabolic Flexibility:

    • Examine how respiratory chain composition reflects adaptation to different energy sources

    • Study how modular respiratory systems contribute to bacterial adaptation to new environments

  • Host-Pathogen Co-evolution:

    • Analyze how interactions with insect hosts drive selection on respiratory components

    • Investigate whether immune priming in hosts like G. mellonella has selected for specific respiratory chain features

  • Horizontal Gene Transfer:

    • Assess whether nuoK and other respiratory components show evidence of horizontal acquisition

    • Determine if gene transfer contributes to the spread of metabolic capabilities among bacterial populations

This research has implications beyond P. entomophila, potentially informing our understanding of how core metabolic systems evolve while maintaining essential functions, and how these changes contribute to pathogenic potential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.