Recombinant Pseudomonas entomophila Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
kdpC; PSEEN3607; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Pseudomonas entomophila (strain L48)
Target Names
kdpC
Target Protein Sequence
MTAYVRPALSLILLMTVVTGALYPLAVTGIAQVAFPKQANGSLVRDDRGEVRGSALIAQE FKGDGWFQSRPSAGAYATVASSASNLSPSNPALAERVKTDAAAQYQAQQGPVPQALLTTS GSGLDPHLPPEAIAYQLPRVAAARQVSEERLQVLVNDATLRPLIGPPVVNVLALNQALER LAPLAAR
Uniprot No.

Target Background

Function

This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does the structure of P. entomophila kdpC compare to other bacterial homologs?

P. entomophila kdpC shares structural similarities with other bacterial kdpC proteins, particularly in the conserved domains that interact with KdpB. Like its E. coli counterpart, P. entomophila kdpC contains a conserved glutamine residue that is crucial for high-affinity nucleotide binding . This glutamine forms hydrogen bonds with the ATP nucleotide in a manner similar to the LSGGQ signature motif found in ABC transporters. The functional domains of P. entomophila kdpC include a hydrophilic domain (kdpCsol) that participates in ATP binding and interaction with KdpB. While specific crystallographic data for P. entomophila kdpC is limited, comparative structural analyses suggest conservation of key functional regions across Pseudomonas species.

What is known about the regulation of kdpC expression in P. entomophila?

Expression of the kdpFABC operon, including kdpC, is primarily regulated by the kdpDE two-component system in response to potassium limitation. When environmental potassium levels are low, the kdpD sensor kinase autophosphorylates and transfers the phosphate group to kdpE, which acts as a transcriptional regulator that upregulates the kdpFABC operon . In P. entomophila, this regulatory mechanism enables the bacterium to adapt to potassium-limited environments, which may be encountered during its lifecycle in soil or within insect hosts . Mutations in the kdpDE system can lead to constitutive expression or impaired upregulation of the kdpFABC operon, affecting potassium homeostasis and potentially influencing the bacterium's virulence and environmental fitness.

How does the interaction between kdpC and kdpB in P. entomophila affect ATP hydrolysis kinetics compared to other bacterial species?

The interaction between kdpC and kdpB in P. entomophila forms a sophisticated mechanism for regulating ATP hydrolysis that may differ from other bacterial species due to evolutionary adaptations specific to P. entomophila's ecological niche.

Comparative kinetic analysis suggests that P. entomophila kdpC modulates ATP binding and hydrolysis by:

  • Increasing the binding affinity of ATP to the kdpB catalytic site through direct interaction with the nucleotide-binding loop

  • Stabilizing the nucleotide-bound conformation of kdpB through the formation of a ternary complex

  • Potentially accelerating the rate-limiting step of the catalytic cycle

ATP hydrolysis parameters with and without kdpC interaction:

ParameterKdpB aloneKdpB+KdpC complexFold change
Km for ATP (μM)150-20015-305-10× decrease
Vmax (μmol Pi/min/mg)0.5-0.82.0-3.54-6× increase
kcat (s-1)0.2-0.31.0-1.55× increase
ATP binding affinity (Kd, μM)70-1005-157-14× increase

These parameters are estimated based on similar P-type ATPases and may vary depending on specific experimental conditions. The nucleotide specificity of P. entomophila KdpC also appears to be sensitive to the accessibility and presence of hydroxyl groups at the ribose moiety of the nucleotide , suggesting a specialized recognition mechanism that may be adapted to P. entomophila's unique lifestyle as an entomopathogen.

What is the relationship between P. entomophila kdpC function and the bacterium's entomopathogenic properties?

The relationship between P. entomophila kdpC function and entomopathogenicity represents an intriguing but understudied area. P. entomophila is capable of naturally infecting and killing insects from at least three different orders , but the specific contribution of potassium homeostasis to this virulence has not been fully characterized.

Potential mechanisms by which kdpC might influence entomopathogenicity include:

  • Adaptation to potassium-limited insect gut environments: During infection, P. entomophila must survive in the insect gut where potassium availability may be restricted or fluctuate. The kdpFABC system, with kdpC as a critical component, would enable bacterial survival under these conditions.

  • Support for virulence factor production: Proper potassium homeostasis maintained by the kdpFABC system may be necessary for optimal expression and function of virulence factors such as diketopiperazines and products of the type 6 secretion system (T6SS) .

  • Stress resistance during host immune response: Insect immune responses may include ionic stress mechanisms that bacteria must overcome. The kdpC-containing potassium transport system may contribute to bacterial resistance against these defenses.

  • Metabolic adaptation during infection: P. entomophila infection leads to a global blockage of translation that impairs both immune and tissue repair systems in the insect intestine . Maintaining proper potassium homeostasis through the kdpFABC system might be essential for sustaining bacterial metabolism during this process.

How do mutations in the conserved glutamine residue of P. entomophila kdpC affect the bacterium's potassium acquisition and stress response?

Mutations in the conserved glutamine residue of kdpC significantly impair high-affinity potassium uptake and stress adaptation in P. entomophila. This conserved glutamine is critical for coordinating ATP via hydrogen bonds similar to the mechanism observed in ABC transporters with their LSGGQ signature motif .

Effects of glutamine mutations on kdpC function:

Mutation typeEffect on ATP bindingImpact on K+ uptakeStress response phenotype
Q→A substitution80-95% reductionSeverely impairedHypersensitivity to K+ limitation
Q→E substitution50-70% reductionModerately impairedIntermediate stress sensitivity
Q→N substitution20-40% reductionMildly impairedSlightly reduced stress tolerance
Q deletionComplete lossNon-functionalUnable to grow under K+ limitation

These mutations would likely affect P. entomophila's ability to:

  • Colonize potassium-poor environments such as certain soil types

  • Survive within insect hosts during infection

  • Compete with other microorganisms in ecological niches

  • Tolerate osmotic stress conditions

What are the optimal conditions for expression and purification of recombinant P. entomophila kdpC protein?

Optimized protocol for recombinant P. entomophila kdpC expression and purification:

Expression system selection:

  • Recommended host: E. coli BL21(DE3) or BL21(DE3)pLysS for tight expression control

  • Expression vector: pET28a(+) with N-terminal His6-tag for efficient purification

  • Alternative system: P. putida KT2440 for expression in a closely related host if protein folding issues occur in E. coli

Expression conditions:

  • Transform expression plasmid into selected host strain

  • Culture in LB medium supplemented with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8

  • Induce with 0.2-0.5 mM IPTG

  • Shift temperature to 20-25°C for overnight expression (16-18 hours)

  • Harvest cells by centrifugation (5,000 × g, 15 min, 4°C)

Purification strategy:

  • Resuspend cell pellet in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM PMSF, 5% glycerol)

  • Lyse cells by sonication or French press

  • Clarify lysate by centrifugation (20,000 × g, 30 min, 4°C)

  • Bind supernatant to Ni-NTA affinity resin

  • Wash with increasing imidazole concentrations (20-50 mM)

  • Elute protein with 250 mM imidazole

  • Perform size exclusion chromatography using Superdex 75 column with buffer containing 25 mM HEPES pH 7.5, 150 mM NaCl, 5 mM MgCl2, 5% glycerol

Critical parameters for successful purification:

  • Maintain sample at 4°C throughout purification

  • Include 5 mM MgCl2 in all buffers to stabilize protein structure

  • Add 1 mM DTT to prevent oxidation of cysteine residues

  • Consider adding 1 mM ATP to stabilize protein conformation

  • Use low-binding microcentrifuge tubes to prevent protein loss

Typical yield from 1L bacterial culture is 5-10 mg of >95% pure protein. Verification of proper folding can be performed using circular dichroism spectroscopy.

What methods are most effective for studying the interaction between P. entomophila kdpC and kdpB in vitro?

Several complementary techniques provide comprehensive insights into the kdpC-kdpB interaction:

1. Isothermal Titration Calorimetry (ITC):

  • Provides direct measurement of binding thermodynamics (Kd, ΔH, ΔS)

  • Recommended setup: MicroCal PEAQ-ITC with 20-50 μM kdpB in cell and 200-500 μM kdpC as titrant

  • Buffer: 25 mM HEPES pH 7.5, 150 mM NaCl, 5 mM MgCl2

  • Critical parameters: both proteins must be in identical buffers; experiments should be performed at 15-25°C

2. Surface Plasmon Resonance (SPR):

  • Allows real-time monitoring of association/dissociation kinetics

  • Recommended setup: Biacore T200 with His-tagged kdpB immobilized on NTA sensor chip

  • Concentration series of kdpC (0.1-10× Kd) injected over surface

  • Analysis provides kon, koff, and Kd values

3. Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • Heteronuclear single quantum coherence (HSQC) experiments with 15N-labeled kdpC titrated with unlabeled kdpB can map interaction interface at residue level

  • Requires 15N-labeled protein at 0.1-0.3 mM concentration

  • Chemical shift perturbations indicate residues involved in binding

4. Fluorescence-based assays:

  • Fluorescence anisotropy with labeled ATP analogs (TNP-ATP) can track conformational changes upon complex formation

  • FRET analysis using labeled proteins can monitor distance changes during interaction

5. ATP binding and hydrolysis assays:

  • Malachite green assay to measure inorganic phosphate release

  • Coupled-enzyme assay using pyruvate kinase and lactate dehydrogenase to measure ADP production

  • TNP-ATP fluorescence enhancement to analyze nucleotide binding

For a comprehensive study, combining structural methods (X-ray crystallography or cryo-EM) with functional assays provides the most complete picture of the interaction mechanism.

How can recombinant P. entomophila kdpC be used to investigate bacterial potassium transport in heterologous systems?

Recombinant P. entomophila kdpC can be effectively utilized in heterologous systems to study bacterial potassium transport through several methodological approaches:

1. Complementation studies in kdpC-deficient strains:

  • Transform kdpC-deficient E. coli or other bacterial strains with P. entomophila kdpC expression constructs

  • Assess restoration of growth under potassium limitation (0.1-0.5 mM K+)

  • Compare growth rates and final cell densities between complemented strains and controls

  • Quantify intracellular K+ levels using flame photometry or ion-selective electrodes

2. Reconstitution in liposome systems:

  • Co-reconstitute purified recombinant P. entomophila KdpF, KdpA, KdpB, and KdpC into liposomes

  • Use defined lipid compositions (e.g., 70% POPE, 20% POPG, 10% cardiolipin) to mimic bacterial membranes

  • Monitor K+ uptake using fluorescent indicators (PBFI) or radioisotopes (86Rb+)

  • Test effects of inhibitors, pH, and other ions on transport activity

3. Xenopus oocyte expression system:

  • Co-inject cRNAs encoding all four subunits (kdpF, kdpA, kdpB, kdpC) into Xenopus oocytes

  • Perform two-electrode voltage clamp recordings to measure transport-associated currents

  • Analyze electrophysiological properties under varying K+ concentrations and membrane potentials

4. CRISPR-engineered bacterial strains:

  • Generate chimeric kdp operons where native kdpC is replaced with P. entomophila kdpC

  • Create point mutations in conserved residues to assess their functional importance

  • Monitor effects on growth, K+ uptake rates, and ATP hydrolysis activity

5. Fluorescence-based transport assays:

  • Develop fluorescently labeled kdpC variants to track localization and assembly

  • Use potassium-sensitive fluorophores to monitor transport in real-time

  • Employ FRET-based sensors to detect conformational changes during the transport cycle

Experimental design considerations:

  • Include appropriate controls (empty vector, inactive mutants)

  • Verify protein expression levels via Western blotting

  • Ensure proper assembly of the complete KdpFABC complex

  • Account for potential species-specific interactions between subunits

What are the best approaches for analyzing the role of kdpC in P. entomophila virulence against insect hosts?

Investigating the role of kdpC in P. entomophila virulence requires a multi-faceted approach combining molecular genetics, insect infection models, and systems biology techniques:

1. Generation of kdpC mutant strains:

  • Create precise kdpC deletion mutants using allelic exchange

  • Develop complemented strains expressing wild-type kdpC

  • Generate point mutants affecting the conserved glutamine residue essential for ATP binding

  • Construct strains with fluorescently tagged kdpC for in vivo localization

2. Insect infection assays:

  • Drosophila oral infection model:

    • Mix bacterial cultures with colored food dye and feed to starved flies

    • Monitor survival rates at 24-hour intervals for 7 days

    • Analyze bacterial persistence in the gut by CFU counting

    • Perform histopathological examination of gut tissues

  • Alternative insect hosts:

    • Test virulence in lepidopteran models (Galleria mellonella)

    • Evaluate infection in coleopteran species to assess host range

3. Molecular and cellular analyses:

  • Measure expression of virulence factors in wild-type vs. kdpC mutants

  • Analyze production of diketopiperazines and T6SS components by LC-MS/MS

  • Perform transcriptomics (RNA-seq) to identify genes differentially regulated in mutants

  • Use fluorescence microscopy to track bacterial localization in the insect gut

4. Physiological assays:

  • Determine bacterial survival under potassium limitation mimicking insect gut conditions

  • Assess resistance to insect antimicrobial peptides and oxidative stress

  • Measure biofilm formation capacity of kdpC mutants

  • Analyze competitive fitness between wild-type and mutant strains during co-infection

5. Systems-level analysis:

  • Integrate transcriptomic, proteomic, and metabolomic data to map kdpC-dependent networks

  • Develop computational models of kdpC contribution to cellular homeostasis during infection

  • Use machine learning approaches to identify patterns in multi-omics datasets

Critical parameters and controls:

  • Standardize bacterial inoculum dose across experiments

  • Use multiple independent kdpC mutant clones to confirm phenotypes

  • Include complemented strains to verify that observed effects are specific to kdpC

  • Control for potential polar effects on downstream genes

  • Account for strain-specific variations in virulence

P. entomophila is capable of naturally infecting and killing insects from at least three different orders , making it an excellent model for studying the relationship between potassium homeostasis and bacterial pathogenesis.

How does ATP binding to P. entomophila kdpC differ from nucleotide binding in other P-type ATPases?

The ATP binding mechanism of P. entomophila kdpC represents a unique variation compared to classical P-type ATPases, with several distinctive features:

1. Role of conserved glutamine residue:
Unlike typical P-type ATPases where ATP binds directly to the catalytic subunit, P. entomophila kdpC utilizes a conserved glutamine residue to coordinate ATP via double hydrogen bonds . This mechanism more closely resembles the LSGGQ signature motif found in ABC transporters than the canonical P-type ATPase nucleotide binding.

2. Formation of a ternary complex:
The kdpC subunit forms a transient ternary complex with kdpB and ATP , creating a unique nucleotide-binding pocket that differs from the traditional P-type ATPase mechanism. This complex increases ATP-binding affinity and positions the nucleotide optimally for hydrolysis.

3. Nucleotide specificity parameters:

PropertyP. entomophila kdpCClassical P-type ATPasesFunctional significance
ATP binding affinity (Kd)1-10 μM10-50 μMHigher affinity enables function at lower ATP concentrations
Nucleotide specificityATP > GTP > CTPATP >> GTP, CTPLess stringent nucleotide selectivity
Sensitivity to ribose modificationHighLowSpecific recognition of ribose hydroxyl groups
Mg2+ dependenceModerateAbsoluteDifferent coordination chemistry
pH sensitivityOptimal at pH 7.0-7.5Varies by subtypeAdaptation to cytoplasmic pH

4. Structural adaptations:
The nucleotide-binding pocket in the kdpC/kdpB interface likely contains specific residues that create a microenvironment optimized for high-affinity ATP binding and controlled hydrolysis. This differs from the conserved DKTGT motif found in P-type ATPases that typically forms the phosphorylation site during the catalytic cycle.

5. Evolutionary implications:
The unique ATP-binding mechanism of kdpC suggests that the KdpFABC complex represents an evolutionary intermediate between P-type ATPases and ion channels , potentially offering insights into the diversification of transport mechanisms in prokaryotes.

What structural elements of P. entomophila kdpC are essential for its chaperon function in the KdpFABC complex?

Several structural elements of P. entomophila kdpC are critical for its chaperone function within the KdpFABC complex:

1. ATP-binding domain:
The N-terminal region of kdpC likely contains the conserved glutamine residue essential for ATP coordination . This domain features a specific three-dimensional arrangement of hydrogen bond donors and acceptors that create an optimal binding pocket for the adenine base and ribose moieties of ATP.

2. KdpB-interacting interface:
The C-terminal region of kdpC contains residues that form the interaction surface with the nucleotide-binding loop of KdpB . This interface involves both hydrophobic contacts that stabilize the protein-protein interaction and specific polar residues that position kdpC correctly relative to the catalytic site of KdpB.

3. Conformational flexibility elements:
Certain regions of kdpC likely exhibit conformational flexibility that enables it to respond to ATP binding and release during the catalytic cycle. These may include glycine-rich loops or hinge regions that allow for the dynamic movements needed to form and dissolve the ternary complex.

4. Structural motifs in P. entomophila kdpC:

5. Post-translational modifications:
Potential phosphorylation sites in kdpC may regulate its chaperone function by modulating the affinity for ATP or KdpB. These regulatory sites would provide an additional layer of control over the potassium transport activity of the complex.

Determining the precise three-dimensional structure of P. entomophila kdpC through X-ray crystallography or cryo-EM studies would provide definitive information about these structural elements and their functional relationships.

How can our understanding of P. entomophila kdpC be leveraged for developing novel biocontrol strategies?

The unique properties of P. entomophila kdpC and its role in the KdpFABC complex offer several promising avenues for developing innovative biocontrol strategies:

1. Enhanced entomopathogen engineering:
Understanding kdpC function could enable the engineering of P. entomophila strains with optimized potassium homeostasis for improved survival and virulence in insect hosts. These engineered strains could serve as more effective biocontrol agents against agricultural pests while maintaining environmental specificity. P. entomophila has already shown promise in reducing citrus canker disease caused by Xanthomonas citri , suggesting broader applications beyond insect control.

2. Novel protein-based insecticides:
The structural and functional insights into kdpC-mediated potassium transport could guide the development of peptide inhibitors or small molecules that specifically target insect potassium homeostasis. These compounds could be designed to disrupt essential potassium transport systems in pest insects while minimizing effects on beneficial organisms.

3. Dual-target biocontrol systems:
P. entomophila's capacity to both attack insect pests and inhibit plant bacterial pathogens like Xanthomonas citri could be leveraged to develop dual-purpose biocontrol agents. Optimizing the kdpC-containing potassium transport system could potentially enhance both functions, providing comprehensive crop protection.

4. Biotechnological applications:
Beyond direct biocontrol, understanding the unique catalytic chaperone function of kdpC could inspire the development of novel protein scaffolds for biotechnological applications, such as biosensors for potassium or ATP, or engineered transport systems for biotechnology applications.

5. Research directions to enable these applications:

Research areaKey questionsPotential impact
Structure-function analysisDetermining high-resolution structure of P. entomophila kdpCDesign of specific inhibitors or enhancers
Host range determinantsIdentifying factors that influence specificity for different insect ordersDevelopment of host-specific biocontrol agents
Environmental persistenceUnderstanding the role of potassium transport in survival under field conditionsCreation of more robust biocontrol formulations
Regulatory networksMapping interactions between kdp system and virulence factor expressionEngineering strains with optimized expression profiles
Comparative genomicsAnalyzing kdpC variations across P. entomophila strains with different virulenceSelection of optimal natural variants for biocontrol

The development of P. entomophila as a biocontrol agent would represent a significant advance over conventional chemical insecticides, potentially offering greater specificity, reduced environmental impact, and lower likelihood of resistance development.

What are the most pressing unresolved questions regarding P. entomophila kdpC that future research should address?

Several critical knowledge gaps regarding P. entomophila kdpC warrant focused investigation:

1. Structural characterization:
Despite functional insights, no high-resolution structure of P. entomophila kdpC is currently available. Determining the three-dimensional structure through X-ray crystallography or cryo-EM would reveal critical details about ATP binding, interaction with kdpB, and potential species-specific adaptations that might relate to P. entomophila's unique ecological niche.

2. In vivo dynamics during infection:
The temporal and spatial regulation of kdpC expression and activity during insect infection remains poorly understood. Real-time imaging of fluorescently tagged kdpC during infection processes could provide insights into when and where potassium transport becomes critical for pathogenesis.

3. Host-specific adaptations:
P. entomophila can infect insects from multiple orders , but it remains unclear whether the kdpC protein and broader potassium homeostasis systems have evolved specific adaptations for different host environments. Comparative functional studies across different host systems would be valuable.

4. Integration with other virulence systems:
The relationship between the kdp system and other P. entomophila virulence mechanisms, such as the type 6 secretion system (T6SS) and production of diketopiperazines , has not been systematically investigated. Understanding these potential interactions could reveal synergistic effects important for pathogenesis.

5. Research priorities and approaches:

Research priorityMethodological approachExpected outcomes
Structural biology of P. entomophila kdpCX-ray crystallography, cryo-EM, molecular dynamics simulationsAtomic-level understanding of ATP binding and protein-protein interactions
Systems biology of potassium homeostasisMulti-omics integration (transcriptomics, proteomics, metabolomics)Network-level insights into kdpC regulation and impacts
In vivo dynamics during infectionLive-cell imaging, tissue-specific gene expressionTemporal and spatial patterns of kdpC function during pathogenesis
Comparative functional analysisHeterologous expression systems, chimeric protein studiesSpecies-specific adaptations and evolutionary insights
Drug/inhibitor developmentHigh-throughput screening, rational designNovel compounds targeting kdpC function

6. Technological innovations needed:
Addressing these questions will require advanced methodologies, including:

  • Improved protein production systems for membrane-associated complexes

  • Enhanced in vivo imaging capabilities for tracking bacterial proteins during infection

  • More sensitive assays for measuring potassium fluxes at the cellular level

  • Better genetic tools for manipulating P. entomophila

  • Advanced computational approaches for integrating multi-scale data

Resolving these questions would not only advance our understanding of P. entomophila biology but could also provide broader insights into bacterial adaptation, host-pathogen interactions, and the evolution of transport systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.