Recombinant Pseudomonas entomophila Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Biochemical and Functional Overview of Recombinant Pseudomonas entomophila Prolipoprotein Diacylglyceryl Transferase (lgt)

Prolipoprotein diacylglyceryl transferase (lgt) is an essential enzyme in Gram-negative bacteria, including Pseudomonas entomophila, catalyzing the transfer of a diacylglyceryl group from phosphatidylglycerol to prolipoproteins. This modification is critical for lipoprotein maturation, membrane localization, and bacterial viability . The recombinant form of P. entomophila lgt is produced as a His-tagged protein (1–269 amino acids) in E. coli, with a molecular weight of approximately 28–30 kDa .

PropertyDetailSource
EC Number2.4.99.- (placeholder for unclassified enzymes)
Gene LocusPSEEN5235 (strain L48)
SubstratePhosphatidylglycerol and prolipoproteins
EssentialityDeletion causes lethality in Gram-negative bacteria

Membrane Topology

Lgt is an inner membrane protein with seven transmembrane segments, oriented with the N-terminus in the periplasm and the C-terminus in the cytoplasm . This topology facilitates interaction with both substrates: phosphatidylglycerol (membrane-bound) and prolipoproteins (cytoplasmic/periplasmic) .

Essential Residues

Site-directed mutagenesis identified critical residues:

ResidueRoleConservation
Y26, N146, G154Absolutely required for activityGram-negative bacteria
R143, E151, R239, E243Important for catalysis or substrate bindingGram-negative bacteria
The "Lgt signature motif" (periplasmic-facing) includes invariant residues critical for phosphatidylglycerol recognition .

Production and Recombinant Expression

Recombinant P. entomophila lgt is typically expressed in E. coli for functional studies and biotechnological applications.

ParameterDetailSource
Expression HostE. coli BL21(DE3)
Purification TagN-terminal His-tag
Yield~50 µg per batch (varies by producer)
Storage-20°C in Tris-based buffer with 50% glycerol

The enzyme is purified via nickel affinity chromatography and validated for structural integrity via SDS-PAGE and functional assays .

Antibiotic-Free Plasmid Selection

The essential nature of lgt enables its use in plasmid stabilization systems:

  1. Δlgt Strains: Deletion of lgt in E. coli or Vibrio cholerae creates auxotrophy for plasmid-borne lgt genes .

  2. Thermosensitive Complementation: Plasmids with V. cholerae-derived lgt allow growth at 30°C but not 37°C, enabling antibiotic-free selection .

  3. High Plasmid Retention: >100% retention observed in E. coli Δlgt strains after 40 generations without selection .

Recombinant Protein Production

  • Soluble Proteins: Glutathione S-transferase (GST) expressed in Δlgt strains retains enzymatic activity .

  • Inclusion Bodies: Cholera toxin B subunit (CTB::p45) fusions form insoluble aggregates but retain pentameric structure post-renaturation .

Purification and Activity

ProteinPurification MethodActivitySource
GSTGlutathione affinityCatechol conversion confirmed
CTB::p45Inclusion body isolationGM1 ganglioside binding post-renaturation

Stability Studies

  • Plasmid Stability: Δlgt strains maintain plasmids >40 generations without selection, eliminating antibiotic dependency .

  • Thermotolerance: E. coli Δlgt strains with V. cholerae lgt grow at 39°C, enabling high-temperature selection .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes section, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. To preserve protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
lgt; PSEEN5235; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Pseudomonas entomophila (strain L48)
Target Names
lgt
Target Protein Sequence
MLPYPQIDPVAVALGPLKIHWYGLMYLIGIGGAWLLASRRLNRFDPTWSREKLSDLVFWL SMGVIVGGRLGYVLFYDLHQYLANPTLIFEVWKGGMSFHGGFIGVMLAALWFGKRNNKSF FELMDFVAPLVPIGLGAGRIGNFINAELWGKATDVPWAMVFPPFSDPAQLPRHPSQLYQF ALEGVALFVILWLYSRKPRPTMAVSGMFALFYGIFRFIVEFVRVPDAQLGYIAFGWLTMG QLLCVPMIVGGIFLIWLAYNRKPTAKATV
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) from *Pseudomonas entomophila* is a key enzyme involved in the biosynthesis of mature lipoproteins. It catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This enzymatic reaction represents the initial step in the formation of mature lipoproteins, which play crucial roles in various cellular processes.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) and what is its function in bacterial systems?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential enzyme that catalyzes the first step in bacterial lipoprotein biosynthesis, transferring a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox motif of prelipoproteins. In Gram-negative bacteria like Pseudomonas species, this modification is critical for anchoring lipoproteins to the bacterial membrane. The lgt enzyme contains multiple transmembrane domains with a central cavity housing the catalytic site where the diacylglyceryl transfer reaction occurs. Structural analysis reveals that lgt comprises seven transmembrane domains (forming the body), two arms that align on the cytoplasmic membrane, and a periplasmic domain (head) . The enzyme is essential for viability in most Gram-negative bacteria, as mutations in lgt are typically lethal in organisms such as Escherichia coli .

What expression systems are most effective for producing recombinant P. entomophila lgt?

Based on experiments with related bacterial species, E. coli BL21 derivatives with lgt deletion (Δlgt) complemented by plasmid-borne lgt genes provide an effective system for recombinant lgt expression . This approach allows for stable maintenance of expression plasmids without antibiotic selection markers, which is particularly valuable for pharmaceutical applications. When expressing P. entomophila lgt, consider the following protocol:

  • Create an lgt-deleted E. coli strain using chromosomal deletion techniques

  • Complement with a temperature-sensitive plasmid carrying a heterologous lgt gene

  • Transform with a temperature-insensitive expression vector carrying P. entomophila lgt

  • Select transformants by growth at elevated temperature (e.g., 39°C)

  • Express the recombinant P. entomophila lgt under control of an inducible promoter

This system has successfully expressed both soluble proteins and those forming inclusion bodies in other systems . When optimizing expression conditions, monitor protein production by Western blotting and assess enzymatic activity through lipoprotein modification assays.

How can I assess the enzymatic activity of recombinant P. entomophila lgt?

The enzymatic activity of recombinant P. entomophila lgt can be assessed using multiple complementary approaches:

  • In vivo complementation assays: Test the ability of P. entomophila lgt to rescue growth in an E. coli Δlgt strain. Effective complementation indicates functional enzyme activity .

  • Globomycin sensitivity test: Active lgt leads to lipoprotein processing by signal peptidase II, which is inhibited by globomycin. Cells with active lgt should be sensitive to globomycin, causing accumulation of prolipoproteins that can be detected by Western blotting .

  • Direct biochemical assay: Measure the transfer of radiolabeled or fluorescently tagged diacylglyceryl from phosphatidylglycerol to a synthetic preprolipoprotein substrate in vitro using purified enzyme.

  • Mass spectrometry: Analyze modification of model lipoproteins in vivo or in vitro to detect the addition of the diacylglyceryl moiety.

  • Membrane integrity assays: Functional lgt is required for proper outer membrane integrity; therefore, membrane permeability tests (e.g., sensitivity to detergents like SDS) can indirectly assess lgt activity .

When interpreting results, compare activity to well-characterized lgt enzymes from E. coli or other Gram-negative bacteria as positive controls.

What structural elements of lgt contribute to substrate specificity, and how might these differ in P. entomophila?

Recent structural studies have revealed that the arm and head domains of lgt play crucial roles in determining substrate specificity among bacterial species . In E. coli lgt, arm-2 along with histidine 103 has been identified as particularly important for protein substrate recognition and binding . For P. entomophila lgt, several structural features likely influence its substrate specificity:

  • Arm domains: The two arm domains that align on the cytoplasmic membrane surface likely contain species-specific residues that recognize particular preprolipoprotein sequences.

  • Central cavity residues: Variations in the amino acids lining the central cavity where the diacylglyceryl transfer occurs would affect substrate binding and catalysis.

  • Periplasmic head domain: This domain shows significant variation between species and likely contributes to differences in substrate recognition.

To investigate P. entomophila lgt substrate specificity, researchers should:

  • Perform structural modeling based on the E. coli lgt crystal structure to identify potential differences

  • Conduct comparative analyses of arm and head domain sequences across Pseudomonas species

  • Design chimeric enzymes swapping domains between P. entomophila and other species to determine regions responsible for specificity

  • Perform site-directed mutagenesis of predicted specificity-determining residues

These approaches would help identify the unique structural elements that determine P. entomophila lgt's substrate preferences, which could be valuable for developing species-specific inhibitors.

How can I establish an lgt-based selection system in Pseudomonas entomophila?

Establishing an lgt-based selection system in P. entomophila would follow similar principles to those demonstrated in E. coli and V. cholerae . This approach provides a valuable antibiotic-free selection system for stable maintenance of expression plasmids. The methodological steps include:

  • Create an lgt-deleted strain:

    • Design flanking regions for homologous recombination

    • Use suicide vector delivery or CRISPR-Cas9 techniques to delete the chromosomal lgt gene

    • Maintain viability with a temperature-sensitive complementation plasmid carrying a heterologous lgt gene (e.g., from E. coli)

  • Construct expression vectors:

    • Design a temperature-insensitive plasmid containing both your gene of interest and the heterologous lgt gene

    • Include appropriate P. entomophila promoters and regulatory elements

  • Selection process:

    • Transform the lgt-deleted strain with your expression vector

    • Select transformants by growth at non-permissive temperature for the complementation plasmid (e.g., 39°C)

    • Verify plasmid maintenance and target gene expression

This system confers extreme stability on expression plasmids without requiring antibiotics, making it particularly valuable for producing recombinant proteins for pharmaceutical applications . When adapting this system to P. entomophila, consider species-specific optimal growth temperatures and ensure the heterologous lgt can functionally complement the P. entomophila lgt deletion.

What are the phenotypic consequences of lgt inhibition or depletion in Gram-negative bacteria?

Inhibition or depletion of lgt in Gram-negative bacteria results in several significant phenotypic consequences with potential applications in antimicrobial development. These effects include:

  • Membrane permeabilization: Lgt depletion leads to compromised outer membrane integrity, increasing permeability to external compounds .

  • Increased antibiotic sensitivity: Bacteria with reduced lgt function show enhanced susceptibility to various antibiotics, particularly those normally excluded by the outer membrane .

  • Serum sensitivity: Lgt-depleted bacteria exhibit increased sensitivity to serum killing, suggesting compromised defense against host immune factors .

  • Cell morphology defects: In E. coli, lgt depletion causes severe morphological abnormalities leading to cell lysis .

  • Lethal phenotype: Complete loss of lgt function is typically lethal in Gram-negative bacteria, unlike other lipoprotein processing enzymes where lethality can be rescued by deleting specific lipoproteins (e.g., Lpp) .

Phenotypic EffectLgt DepletionLsp Inhibition
ViabilityLethalCan be rescued by lpp deletion
Membrane integritySeverely compromisedModerately affected
Antibiotic sensitivityBroadly increasedIncreased for specific antibiotics
MorphologySevere defects leading to lysisVariable depending on species
Lpp dependencyNot rescued by lpp deletionCan be rescued by lpp deletion

These phenotypic effects make lgt an attractive target for novel antimicrobials, as its inhibition appears to have more comprehensive effects than targeting other lipoprotein processing enzymes .

How do the catalytic mechanisms of lgt differ across bacterial species, and what implications does this have for inhibitor design?

Recent large-scale analysis of lgt sequences has led to the definition of a 13-residue Lgt motif and the proposal of an alternative catalytic mechanism compared to earlier models . While the catalytic core appears conserved, subtle differences exist between species that could impact inhibitor design:

For inhibitor design targeting P. entomophila lgt, researchers should:

  • Focus on compounds targeting the highly conserved catalytic site for broad-spectrum activity

  • Target species-specific features in the arm and head domains for narrow-spectrum inhibitors

  • Consider the unique substrate preferences of P. entomophila lgt that might affect inhibitor binding

  • Develop assays to test inhibitor efficacy across multiple bacterial species to assess spectrum of activity

The identification of both broad and narrow-spectrum lgt inhibitors would be valuable for antimicrobial development, with implications for treating infections caused by multidrug-resistant Gram-negative pathogens .

What methodologies can be employed to screen for novel inhibitors specific to P. entomophila lgt?

Developing inhibitors specific to P. entomophila lgt requires sophisticated screening methodologies that account for its unique structural and functional properties. Based on recent advances in lgt inhibitor discovery , the following approaches are recommended:

  • Structure-based virtual screening:

    • Generate a homology model of P. entomophila lgt based on the E. coli lgt crystal structure

    • Perform in silico docking of compound libraries targeting the catalytic site or species-specific regions

    • Select compounds with favorable binding energies and specificity profiles

  • Biochemical high-throughput screening:

    • Develop an in vitro assay using purified recombinant P. entomophila lgt

    • Screen compound libraries measuring inhibition of diacylglyceryl transfer activity

    • Include counter-screens against lgt from other species to identify selective inhibitors

  • Cell-based phenotypic screening:

    • Create a P. entomophila strain with regulatable lgt expression

    • Screen for compounds that phenocopy lgt depletion

    • Confirm targets using resistant mutant generation and sequencing

  • Cyclic peptide screening:

    • Employ mRNA display techniques to identify cyclic peptides that bind specifically to P. entomophila lgt, similar to the approach that identified inhibitor G2428 for E. coli lgt

  • Fragment-based drug discovery:

    • Screen fragment libraries for binding to purified P. entomophila lgt

    • Develop hits through medicinal chemistry optimization

Screening ApproachAdvantagesLimitationsExample Assay Readouts
Structure-basedRational design, fewer compounds to testDepends on model accuracyBinding affinity, docking scores
BiochemicalDirect measure of target inhibitionRequires purified active enzymeFluorescence, radioactivity
PhenotypicIdentifies cell-permeable, active compoundsTarget confirmation neededGrowth inhibition, membrane permeability
Cyclic peptideNovel chemical space, high specificityLimited drug-like propertiesBinding affinity, enzyme inhibition
Fragment-basedEfficient exploration of chemical spaceRequires structural biology supportNMR, thermal shift, crystallography

When developing inhibitors, researchers should consider both potency against P. entomophila lgt and selectivity versus human enzymes to minimize toxicity concerns .

What are the optimal conditions for expressing and purifying recombinant P. entomophila lgt?

Expressing and purifying recombinant P. entomophila lgt presents specific challenges due to its multiple transmembrane domains. Based on successful approaches with lgt from other species, the following optimized protocol is recommended:

  • Expression system selection:

    • Use E. coli C43(DE3) or Lemo21(DE3) strains designed for membrane protein expression

    • Consider an lgt-deleted strain complemented with a heterologous lgt for stable expression

    • Use vectors with tightly controlled inducible promoters (T7 or araBAD)

  • Expression conditions:

    • Grow cultures at reduced temperature (16-20°C) after induction

    • Use low inducer concentrations (0.1-0.4 mM IPTG or 0.02% arabinose)

    • Include membrane-stabilizing additives in the medium (e.g., 1% glucose, 0.5M sorbitol)

  • Membrane preparation:

    • Harvest cells and disrupt by pressure homogenization

    • Separate membranes by ultracentrifugation (100,000 × g, 1 hour)

    • Wash membranes to remove peripheral proteins

  • Solubilization and purification:

    • Solubilize membranes with mild detergents (DDM, LMNG, or DMNG)

    • Purify using nickel affinity chromatography with a C-terminal His-tag

    • Further purify by size exclusion chromatography

  • Quality control:

    • Assess purity by SDS-PAGE and Western blotting

    • Verify activity using in vitro diacylglyceryl transferase assays

    • Analyze protein stability by thermal shift assays

This protocol should yield purified P. entomophila lgt suitable for structural and biochemical studies. For researchers interested in structural studies, consider adding stabilizing mutations in flexible regions based on sequence alignment with E. coli lgt, which has been successfully crystallized .

How can site-directed mutagenesis be used to investigate critical residues in P. entomophila lgt?

Site-directed mutagenesis is a powerful approach to investigate structure-function relationships in P. entomophila lgt. Based on research with E. coli lgt, a systematic mutagenesis strategy should target several categories of residues:

  • Predicted catalytic residues:

    • The histidine equivalent to H103 in E. coli, which is critical for catalysis

    • Conserved residues corresponding to Y26, R143, N146, G154, and R239 in E. coli, which are essential for function

  • Arm and head domain residues:

    • Residues in arm-2 that are predicted to determine substrate specificity

    • Variable residues in the head domain that may contribute to species-specific functions

  • Transmembrane domain residues:

    • Residues lining the central cavity where the diacylglyceryl transfer occurs

    • Residues involved in phospholipid binding

Methodological approach:

  • Design mutagenesis primers targeting specific residues based on sequence alignment with E. coli lgt

  • Create a complementation system using an E. coli Δlgt strain or a P. entomophila conditional lgt mutant

  • Generate an alanine-scanning library of the predicted important residues

  • Express mutant proteins and test for:

    • Ability to complement lgt deletion (functional assay)

    • Protein expression levels by Western blotting

    • In vitro enzymatic activity with purified proteins

    • Binding to substrate analogs

  • For functional residues, create conservative mutations to further probe the role of specific chemical properties

Residue TypeExample MutationsExpected OutcomeAssay Method
CatalyticH→A, H→Q, H→NLoss of functionComplementation, in vitro activity
Substrate bindingR→A, R→K, R→QAltered substrate specificitySubstrate binding assays
StructuralG→A, G→VConformational changesComplementation, thermal stability
Arm domainVariable residues → AlaSpecies-specific activityCross-species complementation

This systematic approach will provide insights into the catalytic mechanism of P. entomophila lgt and identify residues that could be targeted for species-specific inhibitor development .

How can I resolve expression issues when working with recombinant P. entomophila lgt?

Membrane proteins like lgt often present significant expression challenges. Here are systematic approaches to troubleshoot common issues with recombinant P. entomophila lgt expression:

  • Low expression levels:

    • Test multiple promoter strengths (T7, tac, araBAD) to identify optimal expression control

    • Optimize codon usage for the host organism

    • Reduce culture temperature to 16-20°C after induction

    • Try different E. coli strains specialized for membrane protein expression (C43, C41, Lemo21)

    • Add membrane-stabilizing compounds (glycerol, sorbitol) to the growth medium

    • Consider using an lgt-deleted strain complemented with a heterologous lgt gene

  • Protein degradation:

    • Include protease inhibitors during all purification steps

    • Add stabilizing agents (glycerol, specific lipids) to buffers

    • Express in protease-deficient strains (BL21, HM174)

    • Try fusion partners that enhance stability (MBP, SUMO)

  • Inclusion body formation:

    • Reduce induction strength (lower IPTG or arabinose concentration)

    • Express with chaperones (GroEL/ES, DnaK/J)

    • Consider refolding protocols specific for membrane proteins if inclusion bodies are unavoidable

  • Toxicity to host cells:

    • Use tightly regulated expression systems with minimal leaky expression

    • Consider using the lgt-based selection system described for E. coli, which allows stable maintenance of expression plasmids

    • Implement an inducible lgt-complementation system where the chromosomal lgt is deleted and complemented by a plasmid-borne copy under regulatable control

  • Purification challenges:

    • Test multiple detergents for optimal solubilization (DDM, LMNG, DMNG)

    • Include lipids during purification to maintain native-like environment

    • Consider nanodiscs or amphipols for increased stability after purification

By systematically addressing these potential issues, researchers can optimize the expression and purification of functional P. entomophila lgt for subsequent structural and biochemical studies.

How can I distinguish between direct and indirect effects when studying lgt inhibition in P. entomophila?

Distinguishing direct from indirect effects when studying lgt inhibition presents significant challenges due to the enzyme's essential nature and the downstream consequences of lipoprotein processing disruption. Here's a methodological framework to address this challenge:

  • Establish causality through temporal studies:

    • Use inducible expression systems to control lgt levels precisely

    • Track the temporal sequence of phenotypic changes following lgt depletion

    • Primary (direct) effects should manifest before secondary consequences

  • Generate partial loss-of-function mutants:

    • Create point mutations that reduce but don't eliminate lgt activity

    • Compare phenotypes between partial and complete loss-of-function

    • Direct effects should show dose-dependent relationships with activity levels

  • Develop resistant mutants:

    • Select for mutations that confer resistance to lgt inhibitors

    • Characterize whether resistance mutations are in lgt or elsewhere

    • Mutations in lgt suggest direct targeting by the inhibitor

  • Use biochemical validation:

    • Perform in vitro assays with purified lgt to confirm direct inhibition

    • Compare IC50 values between biochemical and cellular assays

    • Similar potency suggests direct mechanism

  • Apply specific molecular markers:

    • Monitor accumulation of unprocessed prolipoproteins by Western blotting

    • Quantify lipid modification of specific lipoprotein substrates by mass spectrometry

    • Track cellular localization of model lipoproteins using fluorescent tags

  • Implement rescue experiments:

    • Test whether overexpression of specific lipoproteins can rescue phenotypes

    • Compare with phenotypes of strains with mutations in other lipoprotein processing enzymes

    • Direct lgt effects might not be rescued by manipulating downstream proteins

  • Employ lpp deletion comparison:

    • Unlike inhibition of Lsp (signal peptidase II), lgt inhibition effects cannot be rescued by deletion of lpp

    • This distinctive characteristic can help distinguish lgt-specific effects

This systematic approach will help researchers accurately attribute phenotypic changes to direct inhibition of P. entomophila lgt rather than secondary effects, enhancing the value of functional studies and inhibitor development efforts.

What computational approaches can predict substrate specificity and inhibitor binding for P. entomophila lgt?

Advanced computational methods offer powerful tools for understanding P. entomophila lgt function and developing specific inhibitors. Based on recent structural insights into lgt enzymes , the following computational approaches are recommended:

  • Homology modeling and molecular dynamics:

    • Build a homology model of P. entomophila lgt based on the E. coli lgt crystal structure

    • Refine the model through extended molecular dynamics simulations in a lipid bilayer environment

    • Identify conformational changes associated with substrate binding and catalysis

    • Analyze flexibility of arm and head domains implicated in substrate specificity

  • Substrate specificity prediction:

    • Analyze the lipobox motifs of predicted P. entomophila lipoproteins using machine learning approaches

    • Perform docking simulations of preprolipoprotein signal sequences to the enzyme model

    • Use molecular mechanics/generalized Born surface area (MM/GBSA) calculations to estimate binding energies

    • Develop a position-specific scoring matrix for P. entomophila lgt substrate preference

  • Virtual screening and inhibitor design:

    • Perform structure-based virtual screening against the catalytic pocket

    • Design focused libraries targeting species-specific features

    • Implement fragment-based approaches to identify novel chemical matter

    • Use free energy perturbation methods to optimize lead compounds

  • Protein-protein interaction modeling:

    • Simulate interactions between the lgt arm domains and preprolipoprotein substrates

    • Identify key residues involved in species-specific recognition

    • Model the impact of mutations on these interactions

Computational MethodApplicationComputational Resources RequiredExpected Outcome
Homology modelingStructure predictionMedium3D model of P. entomophila lgt
Molecular dynamicsDynamic behaviorHigh (GPU clusters)Conformational landscapes, flexible regions
DockingSubstrate/inhibitor bindingMediumBinding poses, interaction patterns
Machine learningSubstrate predictionMedium-HighPrediction algorithm for substrate specificity
Free energy calculationsBinding affinityHighQuantitative estimates of binding energy
Virtual screeningInhibitor discoveryHighRanked lists of potential inhibitors

These computational approaches should be validated experimentally through site-directed mutagenesis, biochemical assays, and inhibitor testing to establish their predictive value for P. entomophila lgt .

How does inhibition of lgt compare to targeting other steps in the bacterial lipoprotein biosynthesis pathway?

Inhibition of different steps in the bacterial lipoprotein biosynthesis pathway produces distinct phenotypic consequences with important implications for antimicrobial development. A comparative analysis reveals:

  • Lgt (first step) inhibition:

    • Typically lethal in Gram-negative bacteria

    • Cannot be rescued by deletion of major lipoprotein lpp

    • Causes severe outer membrane permeabilization

    • Leads to increased sensitivity to serum killing and antibiotics

    • Recently identified inhibitors are bactericidal against wild-type strains

  • Lsp (second step) inhibition:

    • Can be rescued by deletion of lpp in many species

    • Globomycin and myxovirescin are known Lsp inhibitors

    • Structure of enzyme-inhibitor complex with globomycin has been solved

    • Generally less severe phenotypes than lgt inhibition

  • Lnt (third step) inhibition:

    • Essential only in some Gram-negative bacteria

    • Less studied as an antibiotic target

    • More species-specific effects

FeatureLgt InhibitionLsp InhibitionLnt Inhibition
EssentialityEssential in most Gram-negativesEssential unless lpp is deletedVariable across species
Known inhibitorsRecently identified compoundsGlobomycin, myxovirescinLimited
Structural informationX-ray crystal structure availableEnzyme-inhibitor complex solvedLess structural data
Rescue by lpp deletionNoYesDepends on species
Membrane effectsSevere permeabilizationModerate effectsMilder effects
Spectrum potentialBroad-spectrum potentialModerate spectrumNarrow spectrum

The comparative analysis suggests that lgt inhibition may have advantages as an antimicrobial strategy compared to other steps in the pathway, particularly due to:

  • The inability to rescue lethality through lpp deletion

  • More severe membrane permeabilization effects

  • Essential role across most Gram-negative bacteria

  • Potential for both broad and narrow-spectrum inhibitors based on targeting either conserved catalytic sites or variable arm/head domains

These characteristics make P. entomophila lgt and other lgt homologs promising targets for novel antimicrobial development, especially against Gram-negative pathogens where new treatment options are urgently needed .

What are the most promising future research directions for P. entomophila lgt studies?

Based on current knowledge of bacterial lgt enzymes and recent advances in the field , several high-priority research directions emerge for P. entomophila lgt:

  • Structural biology:

    • Determine the crystal or cryo-EM structure of P. entomophila lgt

    • Compare with existing structures to identify species-specific features

    • Resolve enzyme-substrate and enzyme-inhibitor complexes

  • Antimicrobial development:

    • Design and screen for selective inhibitors targeting P. entomophila lgt

    • Develop both broad-spectrum inhibitors (targeting catalytic core) and narrow-spectrum compounds (targeting variable regions)

    • Evaluate synergy between lgt inhibitors and existing antibiotics

  • Synthetic biology applications:

    • Expand the lgt-based selection system demonstrated in E. coli and V. cholerae to P. entomophila

    • Develop antibiotic-free expression systems for recombinant protein production

    • Create biosensors based on lgt substrate specificity

  • Fundamental enzymology:

    • Elucidate the detailed catalytic mechanism of P. entomophila lgt

    • Characterize substrate specificity determinants

    • Map the conformational changes during catalysis

  • Systems biology perspectives:

    • Identify the complete lipoproteome of P. entomophila

    • Determine the physiological consequences of modulating lgt activity on bacterial fitness and virulence

    • Study the evolutionary adaptation of lgt across different Pseudomonas species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.