Recombinant Pseudomonas entomophila Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

Undecaprenyl-diphosphatase (UppP) is encoded by the uppP gene (locus tag: PSEEN2933) in P. entomophila . Key features include:

PropertyDescription
EC Number3.6.1.27
Gene LocusPSEEN2933
Protein Length276 amino acids (residues 1–276 expressed in recombinant form)
Catalytic FunctionHydrolyzes C55-PP to C55-P, releasing inorganic phosphate
Magnesium/Calcium DependenceRequires Mg²⁺ or Ca²⁺ ions for enzymatic activity
Structural MotifsConserved (E/Q)XXXE and PGXSRSXXT motifs, with a critical histidine residue

The enzyme is integral to maintaining the pool of C55-P, which shuttles cell wall precursors across the membrane. Disruption of UppP activity impairs cell wall synthesis, making it a potential antibiotic target .

Enzymatic Activity and Regulation

  • Reaction Mechanism: UppP cleaves the pyrophosphate bond in C55-PP via a metal-dependent hydrolysis. Molecular dynamics simulations suggest that Arg-174 stabilizes the substrate through hydrogen bonding .

  • Kinetic Properties: While specific kinetic parameters for P. entomophila UppP are not yet published, E. coli UppP exhibits a turnover number (k<sub>cat</sub>) of ~12 s⁻¹ and a K<sub>m</sub> of 15 µM for C55-PP .

  • Regulatory Factors: Activity is tightly regulated by divalent cations, with Mg²⁺ or Ca²⁺ being essential for function .

Research Applications

The recombinant enzyme is commercially available for biochemical studies (e.g., ELISA, inhibitor screening) . Key applications include:

  • Antibiotic Development: UppP inhibitors could disrupt cell wall synthesis. Bisphosphonates and tetramic acid derivatives have shown promise against related enzymes .

  • Structural Biology: Used in crystallography or cryo-EM to resolve active-site architecture and substrate interactions .

  • Bacitracin Resistance Studies: UppP overexpression is linked to bacitracin resistance, as it replenishes C55-P pools depleted by this antibiotic .

Future Directions

Further studies on P. entomophila UppP could explore:

  • Substrate specificity compared to homologs in other bacteria.

  • High-throughput screening for species-specific inhibitors.

  • Structural elucidation to validate computational models .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; PSEEN2933; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Pseudomonas entomophila (strain L48)
Target Names
uppP
Target Protein Sequence
MDFWSALQAIILGVVEGLTEFLPISSTGHQIIVADLINFGGERAMAFNIIIQLGAILAVV WEFRRKIFDVVLGLPTQAPARRFTANLLIAFFPAVVLGVLFADLIHEYLFNPITVAAALV VGGVIMLWAERRQHRIEVDHVDEMSWHHALKIGFVQCLAMIPGTSRSGSTIIGGLLFGLS RKAATEFSFFLAMPTMVGAAVYSGYKYRELFQPGDLPVFALGFVVSFIFAMIAVRGLLKF IANHSYAVFAWYRIAFGLLILATWEFGWVDWSTAHG
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (UppP) and what is its role in bacterial cell wall synthesis?

UppP, previously known as BacA, is an integral membrane protein that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (C55-PP) to undecaprenyl phosphate (C55-P) . This reaction is critical because C55-P serves as a lipid carrier for the translocation of peptidoglycan precursors across the bacterial cytoplasmic membrane. In the bacterial cell wall synthesis pathway, UppP performs two essential functions: first, it participates in the de novo synthesis pathway by dephosphorylating newly synthesized C55-PP produced by UppS (undecaprenyl pyrophosphate synthase); second, it contributes to the recycling pathway by dephosphorylating C55-PP released after the transfer of sugar-peptide monomers to the growing peptidoglycan chain .

Beyond peptidoglycan synthesis, undecaprenyl phosphate also functions as a carrier lipid for various other cell wall components including lipopolysaccharides, the enterobacterial common antigen, capsular polysaccharides, and teichoic acids . This versatility in supporting multiple biosynthetic pathways explains why UppP is essential for bacterial viability and represents an attractive target for antibiotic development strategies.

How does P. entomophila UppP compare structurally to UppP from other bacterial species?

P. entomophila UppP shares significant structural and functional similarities with UppP homologs from other bacteria, particularly within the Pseudomonas genus. The enzyme in P. entomophila is 276 amino acids in length and functions as an integral membrane protein with multiple transmembrane domains . The most striking conservation across bacterial species occurs in the enzyme's active site, which contains characteristic (E/Q)XXXE and PGXSRSXXT motifs and a critical histidine residue that are essential for catalytic activity .

The E. coli UppP has been more extensively characterized and demonstrates remarkably high phosphatase activity of approximately 2200 nmol min⁻¹ mg⁻¹ of protein, which is about 7300-fold higher than the basal activity detected in wild-type cell membranes . While specific kinetic parameters for P. entomophila UppP require further investigation, the high degree of conservation in active site architecture suggests similar catalytic mechanisms across species.

Structural analysis indicates that UppP's active site is oriented toward the periplasmic side of the bacterial membrane, suggesting that its biological function occurs on the outer side of the plasma membrane . This topological arrangement has important implications for substrate accessibility and potentially for inhibitor design strategies.

What are the key conserved motifs in P. entomophila UppP?

The activity of P. entomophila UppP depends on several highly conserved motifs that form its active site:

  • The (E/Q)XXXE motif: This glutamate-rich region is critical for coordinating metal ions that are essential for catalytic activity . Mutations in these conserved residues severely impair enzyme function.

  • The PGXSRSXXT motif: This region is proposed to function as a structural P-loop that interacts with the pyrophosphate moiety of the substrate . In E. coli, the R174A mutation within this motif results in complete loss of enzymatic activity, highlighting its critical role in substrate binding or catalysis.

  • A conserved histidine residue (equivalent to His-30 in E. coli UppP): This residue is spatially close to the pyrophosphate moiety and is essential for enzymatic activity . The H30A mutation in E. coli UppP severely compromises enzyme function.

The full amino acid sequence of P. entomophila UppP reveals these conserved regions within the context of its complete 276-amino acid sequence, which includes multiple transmembrane domains typical of integral membrane proteins . Sequence analysis and modeling studies suggest that these critical motifs are located near the aqueous interface of the membrane protein and oriented toward the periplasmic space, creating a properly positioned active site for interaction with the pyrophosphate moiety of the substrate.

What expression systems are most effective for recombinant P. entomophila UppP production?

Effective recombinant expression of P. entomophila UppP requires systems optimized for integral membrane proteins. Based on successful approaches with homologous proteins, recommended expression strategies include:

E. coli C41(DE3) strain represents an optimal host for UppP expression due to its ability to accommodate potentially toxic membrane proteins . This strain contains mutations that prevent cell death associated with overexpression of membrane proteins while maintaining high expression levels. For expression vectors, systems with tunable promoters such as pET vectors with T7 promoter provide controlled expression capabilities.

A particularly effective approach demonstrated with E. coli UppP involved fusion protein strategies using bacteriorhodopsin as a tag at the N-terminus of the target protein . This strategy facilitates proper membrane insertion, increases stability, and provides a visual indicator of expression through the characteristic purple color of bacteriorhodopsin when combined with all-trans-retinal.

A typical expression protocol adapted from studies on E. coli UppP would include:

  • Transformation of the expression vector into E. coli C41(DE3)

  • Growth in LB medium with appropriate antibiotics at 37°C until OD600 reaches 0.9

  • Induction with 0.5 mM IPTG

  • Addition of 5-10 mM all-trans-retinal for bacteriorhodopsin-fusion constructs

  • Continued growth for 5 hours at 37°C

  • Cell harvesting by centrifugation

This approach has been demonstrated to produce sufficient quantities of functional UppP for subsequent purification and characterization.

What are the optimal conditions for solubilization and purification of P. entomophila UppP?

The successful solubilization and purification of P. entomophila UppP require careful selection of detergents and buffer conditions that maintain protein structure and function. Based on approaches used for homologous proteins, an effective purification strategy would include:

  • Membrane preparation:

    • Cell disruption using Constant Cell Disruption Systems or similar methods

    • Collection of membrane fraction by ultracentrifugation at 40,000 rpm for 1.5 hours

  • Solubilization:

    • n-dodecyl-β-D-maltoside (DDM) at 1% (w/v) has been successfully used for UppP homologs

    • Solubilization buffer typically containing Tris (pH 7.5) with 500 mM NaCl

  • Purification strategy:

    • Affinity chromatography using histidine-tagged UppP

    • Size-exclusion chromatography for further purification

    • Buffer optimization including 50% glycerol for protein stabilization

For recombinant P. entomophila UppP available commercially, the protein is typically supplied in a Tris-based buffer with 50% glycerol optimized for protein stability . Storage recommendations include keeping the protein at -20°C for short-term use or -80°C for extended storage, with aliquoting to avoid repeated freeze-thaw cycles that can compromise activity .

The critical consideration throughout the purification process is maintaining detergent concentrations above the critical micelle concentration to prevent protein aggregation while minimizing excess detergent that might interfere with subsequent applications.

How can enzyme activity be measured and characterized for recombinant P. entomophila UppP?

Several complementary approaches can be employed to measure and characterize the phosphatase activity of recombinant P. entomophila UppP:

  • Colorimetric phosphate detection assays:

    • Malachite green assay provides quantitative detection of released inorganic phosphate

    • The assay measures formation of a complex between malachite green, ammonium molybdate, and free phosphate

    • Quantification by measuring absorbance at 620-640 nm

  • Radiolabeled substrate assays:

    • Using ³²P-labeled undecaprenyl pyrophosphate as substrate

    • Separation of substrate and product by thin-layer chromatography

    • Quantification through autoradiography or scintillation counting

A typical activity assay would contain:

  • Purified recombinant P. entomophila UppP (0.1-1 μg)

  • Undecaprenyl pyrophosphate substrate (50-200 μM)

  • Buffer system (typically Tris or HEPES, pH 7.5)

  • Divalent cations (Mg²⁺ or Mn²⁺, 5-10 mM)

  • Detergent at concentrations above CMC

  • Incubation at 30-37°C for specified time periods

Kinetic characterization would involve determining:

  • Km for undecaprenyl pyrophosphate substrate

  • kcat (turnover number)

  • kcat/Km (catalytic efficiency)

  • Optimal pH and temperature for activity

  • Effects of potential inhibitors

The E. coli UppP homolog has demonstrated a high phosphatase activity of approximately 2200 nmol min⁻¹ mg⁻¹ of protein , providing a benchmark for comparison with the P. entomophila enzyme.

What computational approaches can be used to model P. entomophila UppP structure?

Several computational approaches have proven valuable for modeling the structure of membrane proteins like P. entomophila UppP:

A comprehensive computational approach would integrate these methods, starting with model building, followed by refinement through molecular dynamics, and validation through comparison with experimental data including mutagenesis results. For UppP, structural models place the active site containing the (E/Q)XXXE and PGXSRSXXT motifs near the aqueous interface and oriented toward the periplasmic space . These models predict that conserved residues create a binding pocket for the pyrophosphate moiety of the substrate, with the lipid portion extending into the membrane.

How do mutations in key residues affect P. entomophila UppP function?

Mutagenesis studies on UppP homologs provide valuable insights into structure-function relationships that likely apply to P. entomophila UppP. Key findings include:

  • Mutations in the (E/Q)XXXE motif:

    • Alterations to these conserved glutamate residues disrupt metal coordination essential for catalytic activity

    • These mutations typically result in severely impaired enzyme function

  • Mutations in the PGXSRSXXT motif:

    • The arginine residue (equivalent to R174 in E. coli UppP) is particularly critical

    • The R174A mutation in E. coli UppP results in complete inactivation of the enzyme

    • This residue likely establishes hydrogen bonds with the OH group of the pyrophosphate moiety

  • Mutation of the conserved histidine:

    • The H30A mutation in E. coli UppP severely impairs enzyme activity

    • This histidine residue is spatially close to the pyrophosphate moiety and likely participates directly in catalysis

A systematic mutagenesis approach coupled with activity assays would allow mapping of the critical residues in P. entomophila UppP specifically. Such studies provide not only fundamental insights into enzyme mechanism but also identify potential targets for inhibitor design. The data demonstrate that the active site of UppP is composed of these two consensus regions, providing a first insight into structure-function relationships of UppP in E. coli and probably in other bacterial species including P. entomophila .

What is the proposed catalytic mechanism of P. entomophila UppP?

Based on structural models and mutagenesis studies, the following catalytic mechanism can be proposed for P. entomophila UppP:

  • Substrate binding:

    • The pyrophosphate moiety of undecaprenyl pyrophosphate interacts with the PGXSRSXXT motif

    • The conserved arginine within this motif (equivalent to R174 in E. coli) forms hydrogen bonds with the substrate

    • The undecaprenyl lipid chain extends into the membrane environment

  • Catalytic hydrolysis:

    • The conserved histidine (equivalent to H30 in E. coli) likely acts as a general base, activating a water molecule for nucleophilic attack on the phosphorus atom

    • The (E/Q)XXXE motif coordinates divalent metal ions (Mg²⁺ or Mn²⁺) that stabilize the negative charges of the pyrophosphate during the reaction

    • These metal ions may also position the substrate optimally for attack by the activated water

  • Product release:

    • After hydrolysis, undecaprenyl phosphate and inorganic phosphate are formed

    • The products dissociate from the enzyme, allowing a new catalytic cycle to begin

This mechanism is consistent with the orientation of the active site toward the periplasmic side of the membrane, suggesting that dephosphorylation of undecaprenyl pyrophosphate occurs on the outer side of the plasma membrane . This periplasmic orientation has important implications for the recycling of undecaprenyl phosphate during cell wall synthesis.

How can P. entomophila UppP research contribute to antibiotic development?

P. entomophila UppP research offers several promising avenues for antibiotic development:

  • Target validation:

    • UppP is essential for bacterial cell wall synthesis and viability

    • Its role in undecaprenyl phosphate metabolism makes it a critical node in peptidoglycan biosynthesis

    • Inhibition of UppP would disrupt multiple cell wall synthesis pathways simultaneously

  • Structure-based inhibitor design:

    • The identified active site containing (E/Q)XXXE and PGXSRSXXT motifs provides a defined target for inhibitor development

    • Computer modeling combined with experimental validation can guide rational design of molecules that compete with the natural substrate

    • Understanding the membrane topology with the active site oriented toward the periplasm informs inhibitor design strategies

  • Novel antibacterial mechanisms:

    • UppP inhibitors would work through a mechanism distinct from existing antibiotics

    • This novel mode of action could overcome existing resistance mechanisms

    • The World Health Organization has classified carbapenem-resistant Pseudomonas aeruginosa in the high-priority category of bacterial pathogens requiring new antimicrobials

  • Combination therapy approaches:

    • UppP inhibitors could potentially synergize with existing cell wall-targeting antibiotics

    • Combining UppP inhibitors with drugs targeting other steps in peptidoglycan synthesis might prevent resistance development

The continued emergence of multidrug-resistant bacterial pathogens, particularly in the Pseudomonas genus, underscores the urgent need for new antibacterial targets and mechanisms. UppP represents one such promising target that has not yet been fully exploited in clinical antibiotics.

What role does UppP play in bacterial resistance mechanisms?

UppP contributes to bacterial resistance through several mechanisms:

  • Bacitracin resistance:

    • UppP is also known as bacitracin resistance protein in P. entomophila

    • Bacitracin acts by binding to undecaprenyl pyrophosphate, preventing its dephosphorylation and recycling

    • Overexpression of UppP increases the conversion of the target (undecaprenyl pyrophosphate) to undecaprenyl phosphate, reducing bacitracin effectiveness

  • Cell wall integrity maintenance:

    • UppP ensures continuous supply of undecaprenyl phosphate for cell wall synthesis

    • This activity becomes critical when bacteria are exposed to cell wall-targeting antibiotics

    • Enhanced UppP activity could help bacteria maintain cell wall integrity under antibiotic stress

  • Cross-resistance potential:

    • Given that undecaprenyl phosphate serves as a carrier for multiple cell wall components, alterations in UppP activity could potentially affect susceptibility to various classes of antibiotics

    • This includes not only peptidoglycan-targeting antibiotics but also those affecting other cell envelope structures

Understanding the specific contribution of UppP to resistance phenotypes in P. entomophila and related species could inform strategies to overcome or circumvent these resistance mechanisms.

How does P. entomophila UppP compare to homologs in other Pseudomonas species?

The Pseudomonas genus exhibits both conservation and variation in UppP homologs:

  • Sequence conservation:

    • The core catalytic motifs (E/Q)XXXE and PGXSRSXXT are highly conserved across Pseudomonas species

    • The full-length protein in P. entomophila consists of 276 amino acids , comparable to homologs in other species

  • Species-specific variations:

    • Different Pseudomonas species occupy diverse ecological niches, from environmental bacteria to plant associates to human pathogens

    • These different lifestyles may have driven subtle adaptations in UppP function or regulation

    • P. entomophila is specifically adapted to insect hosts, while P. aeruginosa is an opportunistic human pathogen

  • Clinical relevance:

    • P. aeruginosa represents a priority pathogen for antimicrobial development according to the WHO

    • Understanding similarities and differences between UppP from various Pseudomonas species can guide development of either narrow-spectrum or broad-spectrum inhibitors

  • Horizontal gene transfer considerations:

    • The Pseudomonas genus shows evidence of horizontal gene transfer events that have shaped the evolution of various gene families

    • Analysis of UppP sequences across species can provide insights into evolutionary relationships and potential horizontal transfer events

Comparative genomic and biochemical studies of UppP across Pseudomonas species offer opportunities to understand both the core conserved functions of this enzyme family and species-specific adaptations that might influence pathogenicity or environmental fitness.

What methodological challenges exist in structural studies of P. entomophila UppP?

Structural characterization of membrane proteins like P. entomophila UppP presents several significant challenges:

  • Expression and purification obstacles:

    • Achieving sufficient quantities of pure, properly folded protein for structural studies

    • Maintaining protein stability throughout the purification process

    • Selecting appropriate detergents that solubilize the protein while preserving native structure

  • Crystallization difficulties:

    • Membrane proteins typically have limited hydrophilic surfaces for crystal contacts

    • Detergent micelles can interfere with crystal packing

    • Conformational heterogeneity can prevent formation of well-ordered crystals

  • Alternative structural approaches:

    • Cryo-electron microscopy for membrane proteins that resist crystallization

    • NMR spectroscopy for specific domains or in detergent micelles

    • Integrating computational modeling with limited experimental constraints

  • Active site characterization:

    • Capturing the enzyme in catalytically relevant conformations

    • Co-crystallization with substrate analogs or inhibitors

    • Understanding the dynamics of the active site during catalysis

Despite these challenges, computational approaches have provided valuable insights, including the identification of the active site composed of (E/Q)XXXE and PGXSRSXXT motifs oriented toward the periplasmic side of the membrane . Continued advancement in membrane protein structural biology techniques promises to overcome these obstacles and provide more detailed insights into UppP structure and function.

How can high-throughput screening approaches be optimized for UppP inhibitor discovery?

Developing effective high-throughput screening (HTS) approaches for P. entomophila UppP inhibitors requires addressing several key considerations:

  • Assay development:

    • Adaptation of phosphatase activity assays to microplate format

    • Development of fluorescent or luminescent readouts for increased sensitivity

    • Optimization of signal-to-noise ratio for reliable hit identification

    • Miniaturization to reduce protein and reagent consumption

  • Compound library selection:

    • Focusing on chemical scaffolds with appropriate physicochemical properties for membrane protein interaction

    • Including compounds with structural features that might interact with the identified active site motifs

    • Considering natural product libraries that may contain lipid-interacting compounds

  • Counter-screening strategy:

    • Secondary assays to confirm hits and eliminate false positives

    • Selectivity screening against mammalian phosphatases

    • Cell-based assays to confirm antimicrobial activity of confirmed hits

  • Structure-activity relationship studies:

    • Systematic modification of hit compounds to improve potency and selectivity

    • Correlation of inhibitory activity with specific structural features

    • Computational modeling to guide optimization

The identified active site containing (E/Q)XXXE and PGXSRSXXT motifs and the essential histidine residue provides specific targets for rational inhibitor design , which can complement high-throughput screening approaches for discovering novel UppP inhibitors.

What potential exists for developing dual-targeting inhibitors affecting UppP and related cell wall biosynthesis enzymes?

The strategic position of UppP in bacterial cell wall biosynthesis opens possibilities for dual-targeting inhibitor development:

  • Integrated peptidoglycan synthesis targeting:

    • Designing inhibitors that affect both UppP and other enzymes in the peptidoglycan synthesis pathway

    • Targeting multiple steps in the undecaprenyl phosphate cycle

    • Combining inhibition of initial lipid carrier synthesis with recycling pathways

  • Mechanistic considerations:

    • UppP active site with (E/Q)XXXE and PGXSRSXXT motifs has distinct characteristics

    • Identifying structural similarities with active sites of other cell wall synthesis enzymes

    • Designing inhibitors with pharmacophores that can interact with multiple related targets

  • Potential advantages:

    • Reducing the likelihood of resistance development

    • Achieving synergistic inhibition for enhanced antibacterial effect

    • Addressing the priority pathogen status of carbapenem-resistant Pseudomonas species

  • Target combinations:

    • UppP and UppS (undecaprenyl pyrophosphate synthase)

    • UppP and MraY (phospho-MurNAc-pentapeptide translocase)

    • UppP and penicillin-binding proteins

The interconnected nature of bacterial cell wall biosynthesis pathways presents opportunities for multi-targeting approaches that could lead to more effective and resistance-resistant antibiotics. Research exploring these integrated strategies could significantly advance our antibacterial arsenal against threatening pathogens like multidrug-resistant Pseudomonas species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.