Recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudomonas fluorescens ATP Synthase Subunit a (atpB)

Recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB) is a genetically engineered protein derived from the bacterium Pseudomonas fluorescens. This protein is part of the ATP synthase complex, which plays a crucial role in energy production by synthesizing ATP from ADP and inorganic phosphate using the energy generated from a proton gradient across the cell membrane.

Key Features:

  • Expression System: The recombinant protein is typically expressed in Escherichia coli (E. coli) for ease of production and purification.

  • Tagging: The protein is often fused with a His-tag at the N-terminal to facilitate purification using affinity chromatography.

  • Function: ATP synthase is essential for maintaining cellular energy homeostasis by generating ATP, which is vital for various cellular processes.

Structure and Function of ATP Synthase

ATP synthase is a complex enzyme consisting of two main parts: the F1 sector, which contains the catalytic sites for ATP synthesis, and the Fo sector, which spans the membrane and is responsible for proton translocation. The subunit a (atpB) is part of the Fo sector and plays a crucial role in proton transport across the membrane.

Structure of ATP Synthase:

ComponentFunction
F1 SectorCatalytic sites for ATP synthesis
Fo SectorProton translocation across the membrane
Subunit a (atpB)Essential for proton transport

Recombinant Expression and Purification

The recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB) is expressed in E. coli due to its well-established genetic manipulation tools and efficient protein production capabilities. The protein is often tagged with a His-tag to simplify purification using nickel-affinity chromatography.

Expression and Purification Steps:

  1. Cloning: The gene encoding atpB is cloned into an expression vector.

  2. Transformation: The vector is transformed into E. coli cells.

  3. Expression: The protein is expressed under controlled conditions.

  4. Purification: The His-tagged protein is purified using nickel-affinity chromatography.

Applications:

  • Biotechnology: ATP synthases can be engineered for enhanced energy production in microbial systems.

  • Bioenergy: Understanding ATP synthase mechanisms can inform the development of bio-inspired energy conversion systems.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand your specific requirements. If you need a particular format, please specify it in your order remarks and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, kindly consult your local distributors.
Note: All protein shipments are standardly sent with blue ice packs. If you require dry ice, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
atpB; Pfl01_5736; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Pseudomonas fluorescens (strain Pf0-1)
Target Names
atpB
Target Protein Sequence
MAETTASGYIQHHLQNLTFGQLPNGGWGFAHTAAEAKEMGFWAFHVDTLGWSVALGLIFV LLFRMAAKKATSGQPGALQNFVEVLVEFVDGSVKDSFHGRSPVIAPLALTIFVWVFLMNA VDLVPVDWVPQLAILISGDHHIPFRAVSTTDPNATLGMAFSVFALIIFYSIKVKGLGGFI GELTLHPFGSKNIFVQALLIPVNFLLEFVTLIAKPISLALRLFGNMYAGELVFILIAVMF GSGLLWLSGLGVVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEENH
Uniprot No.

Target Background

Function
As a key component of the proton channel, ATP synthase subunit a (atpB) plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Pseudomonas fluorescens ATP synthase subunit a (atpB)?

Pseudomonas fluorescens ATP synthase subunit a (atpB) is a 290-amino acid membrane protein that forms a critical component of the F0 sector of the ATP synthase complex. According to the amino acid sequence data, the protein contains multiple transmembrane domains that span the bacterial membrane . The full sequence (UniProt ID: Q4K3A3) reveals its highly hydrophobic nature, consistent with its membrane-embedded location .

Functionally, atpB forms part of the proton channel within the ATP synthase complex, facilitating the movement of protons down their electrochemical gradient across the bacterial membrane. This proton movement drives the rotation of the c-ring in the F0 sector, which couples to the F1 sector to enable ATP synthesis. The protein works in concert with other ATP synthase components to harness the energy from proton gradients to synthesize ATP during oxidative phosphorylation.

In Pseudomonas fluorescens specifically, this protein contributes to the organism's remarkable bioenergetic flexibility, allowing it to maintain ATP production even under challenging environmental conditions such as oxidative stress .

How is recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB) typically produced for research purposes?

Production of recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB) typically involves heterologous expression in Escherichia coli expression systems. Based on available data, the recombinant protein is commonly expressed with an N-terminal His tag to facilitate purification .

The standard production protocol includes:

  • Gene cloning and insertion into an expression vector with an N-terminal His tag

  • Transformation into E. coli expression strains

  • Culture growth and protein expression induction

  • Cell harvesting and lysis to release the protein

  • Affinity purification using nickel or cobalt resin to capture the His-tagged protein

  • Quality control assessment, typically achieving >90% purity as determined by SDS-PAGE

  • Processing into lyophilized powder form for storage and distribution

This approach enables researchers to obtain purified recombinant protein suitable for structural studies, functional assays, and antibody production. The His tag provides a convenient purification handle while generally maintaining the protein's functional integrity.

What are the optimal storage and handling conditions for this recombinant protein?

Optimal storage and handling of recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB) requires specific conditions to maintain stability and activity. According to published protocols, the following conditions are recommended:

Storage conditions:

  • Long-term storage: -20°C or -80°C for maximum stability

  • Working aliquots: 4°C for up to one week

  • Aliquoting is necessary to prevent repeated freeze-thaw cycles, which can degrade the protein

Reconstitution protocol:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for long-term storage, with 50% being the standard recommendation

Buffer composition:

  • The protein is typically stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0

  • This buffer composition helps maintain protein stability during freeze-thaw cycles

Following these guidelines ensures that the recombinant protein maintains its structural integrity and functional properties for experimental use.

How does oxidative stress affect ATP synthase function in Pseudomonas fluorescens, and what compensatory mechanisms maintain ATP homeostasis?

Oxidative stress significantly impacts ATP synthase function in Pseudomonas fluorescens, yet remarkably, the organism maintains ATP homeostasis through sophisticated compensatory mechanisms. Research has demonstrated that despite oxidative stress (H₂O₂ and nitrosative stress) typically impeding the tricarboxylic acid (TCA) cycle and oxidative phosphorylation, P. fluorescens continues to proliferate under these challenging conditions .

  • Phospho-transfer networks mediated by:

    • Acetate kinase (ACK) - generates ATP during acetyl phosphate to acetate conversion

    • Adenylate kinase (AK) - catalyzes interconversion of adenine nucleotides (2ADP ↔ ATP + AMP)

    • Nucleoside diphosphate kinase (NDPK) - transfers phosphate groups between nucleotides

  • Enhanced substrate-level phosphorylation through upregulation of:

    • Phosphoenolpyruvate carboxylase (PEPC)

    • Pyruvate orthophosphate dikinase (PPDK)

    • Phosphoenolpyruvate synthase (PEPS)

These enzymes increase the production of phosphoenolpyruvate (PEP) and pyruvate, which further fuel ATP synthesis through substrate-level phosphorylation pathways that do not require the electron transport chain or ATP synthase directly.

This metabolic reconfiguration enables P. fluorescens to fulfill its ATP requirements in an oxygen-independent manner through an intricate "phospho-wire" module that maximizes energy production from alternative pathways when oxidative phosphorylation is compromised .

What methodological approaches are most effective for studying the function of recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB)?

Studying the function of recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB) requires specialized methodological approaches due to its nature as a membrane protein that functions as part of a complex. The most effective research strategies include:

These methodological approaches can be combined to provide comprehensive functional characterization of the recombinant protein, particularly in the context of understanding P. fluorescens' remarkable ability to maintain ATP homeostasis under stress conditions .

How can site-directed mutagenesis of this protein provide insights into its mechanism of action?

Site-directed mutagenesis of recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB) serves as a powerful approach to elucidate the molecular mechanism of this protein's function in proton translocation and energy coupling. This methodological approach can provide critical insights through systematic alteration of key amino acids.

The most informative site-directed mutagenesis strategy involves:

  • Systematic targeting of functional residues:

    • Conserved charged amino acids (Arg, Asp, Glu) in transmembrane segments that likely participate in proton translocation

    • Residues predicted to form the interface with the c-ring subunit

    • Amino acids potentially lining the proton half-channels

    • Hydrophilic residues in otherwise hydrophobic transmembrane regions

  • Types of mutations to introduce:

    • Conservative substitutions (e.g., Arg→Lys, Asp→Glu) to test charge requirements

    • Charge neutralization (e.g., Arg→Gln, Asp→Asn) to assess electrostatic contributions

    • Charge reversal (e.g., Arg→Glu, Asp→Arg) to test potential salt-bridge formations

    • Hydrophobicity alterations to probe structural requirements

  • Functional characterization of mutants:

    • Proton translocation efficiency measurements

    • ATP synthesis capacity under defined proton gradients

    • Interaction integrity with other ATP synthase subunits

    • Structural stability assessments

This approach has successfully identified essential residues in ATP synthase from other organisms, particularly a highly conserved arginine residue that plays a critical role in the proton translocation mechanism. Similar studies with P. fluorescens atpB would provide valuable comparative data and could potentially reveal unique adaptations that contribute to this organism's remarkable metabolic flexibility under stress conditions .

What role does this protein play in maintaining energy homeostasis during environmental stress responses?

Pseudomonas fluorescens ATP synthase subunit a (atpB) plays a complex and multifaceted role in maintaining energy homeostasis during environmental stress responses. Research has demonstrated that P. fluorescens exhibits remarkable metabolic adaptability when faced with stressors that typically compromise energy production.

  • Primary function under stress:

    • When oxidative stress impedes the electron transport chain, the proton gradient driving ATP synthase is diminished

    • The protein's direct contribution to ATP synthesis becomes reduced

    • ATP synthase may undergo regulatory modifications to adjust to the altered energetic landscape

  • Integration with stress-induced metabolic reprogramming:

    • P. fluorescens activates alternative ATP-generating phospho-transfer networks when ATP synthase function is compromised

    • The phospho-relay machinery orchestrated by substrate-level phosphorylation becomes more prominent

    • Enzymes like PEPC, PPDK, and PEPS are upregulated to enhance phosphoenolpyruvate (PEP) and pyruvate production

  • Contribution to cellular adaptation:

    • ATP synthase components may serve additional regulatory roles during stress

    • The protein contributes to the organism's remarkable ability to maintain ATP homeostasis despite diminished TCA cycle and oxidative phosphorylation activities

This metabolic flexibility, where P. fluorescens can fulfill its ATP requirements in an O2-independent manner during stress, represents a sophisticated adaptation that likely contributes to this organism's ecological versatility and ability to thrive in diverse and challenging environments.

How do the phospho-transfer networks in Pseudomonas fluorescens interact with ATP synthase function?

Phospho-transfer networks in Pseudomonas fluorescens exhibit a sophisticated interrelationship with ATP synthase function, particularly evident during stress conditions. Research has elucidated how these networks complement and compensate for ATP synthase activity to maintain energy homeostasis.

  • Primary phospho-transfer enzymes activated during stress:

    • Acetate kinase (ACK): Generates ATP during the conversion of acetyl phosphate to acetate

    • Adenylate kinase (AK): Catalyzes the interconversion of adenine nucleotides (2ADP ↔ ATP + AMP)

    • Nucleoside diphosphate kinase (NDPK): Transfers phosphate groups between nucleotides

  • Metabolic integration with ATP synthase:

    • These phospho-transfer networks provide alternative routes for ATP generation when the proton gradient driving ATP synthase is diminished

    • They help maintain critical ATP levels for essential cellular processes

    • The integrated network ensures energy homeostasis despite fluctuations in ATP synthase efficiency

  • Enhanced substrate-level phosphorylation:

    • Upregulation of enzymes like phosphoenolpyruvate carboxylase (PEPC), pyruvate orthophosphate dikinase (PPDK), and phosphoenolpyruvate synthase (PEPS)

    • Increased production of phosphoenolpyruvate (PEP) and pyruvate to fuel ATP synthesis

    • This substrate-level phosphorylation complements the decreased ATP production via ATP synthase

This intricate "phospho-wire" module represents a remarkable metabolic adaptation that maximizes energy production from multiple sources, enabling P. fluorescens to fulfill its ATP requirements even when the conventional ATP synthase pathway is compromised . This metabolic flexibility likely contributes to this organism's ability to thrive in diverse and challenging environments.

What purification strategies yield the highest purity and activity of recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB)?

Purification of recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB) requires specialized strategies to maintain protein integrity while achieving high purity. Based on established protocols, the following multi-step purification approach yields optimal results:

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Primary purification exploiting the N-terminal His tag

    • Optimal conditions include:

      • Binding buffer: 50 mM Tris-HCl (pH 8.0), 300-500 mM NaCl, 10-20 mM imidazole

      • Washing steps with gradually increasing imidazole (20-50 mM)

      • Elution with 250-300 mM imidazole

    • Critical addition: 0.05-0.1% suitable detergent (DDM or LMNG) to maintain membrane protein solubility

  • Size Exclusion Chromatography (SEC):

    • Secondary purification to remove aggregates and non-specifically bound proteins

    • Optimal columns: Superdex 200 or Sephacryl S-300

    • Buffer: 20 mM Tris-HCl (pH 8.0), 150 mM NaCl, 0.03-0.05% detergent

  • Quality control assessment:

    • SDS-PAGE analysis to confirm >90% purity

    • Western blotting using anti-His antibodies to verify identity

    • Mass spectrometry for definitive identification

  • Storage preparation:

    • Buffer exchange to Tris/PBS-based buffer with 6% trehalose, pH 8.0

    • Lyophilization for long-term stability

    • Aliquoting to prevent repeated freeze-thaw cycles

This approach consistently yields protein with >90% purity as determined by SDS-PAGE , suitable for structural and functional studies. For functional studies requiring reconstitution into liposomes, particular attention must be paid to detergent selection and removal strategies to maintain the protein's native conformation and activity.

What are the most effective methods for measuring ATP synthase activity in reconstituted membrane systems?

Measuring ATP synthase activity in reconstituted membrane systems containing Pseudomonas fluorescens ATP synthase subunit a (atpB) requires specialized techniques that assess both proton translocation and ATP synthesis/hydrolysis. The most effective methodological approaches include:

  • Proton translocation assays:

    • Fluorescence-based measurements using pH-sensitive dyes:

      • ACMA (9-amino-6-chloro-2-methoxyacridine): Quenching indicates acidification of liposome interior

      • Pyranine (8-hydroxypyrene-1,3,6-trisulfonic acid): Ratiometric measurements of internal pH

    • Protocol details:

      • Liposomes containing reconstituted ATP synthase at 0.1-0.5 mg/ml protein

      • Addition of ATP (2-5 mM) to initiate proton pumping (ATP hydrolysis mode)

      • Monitoring fluorescence changes over time (typically 10-15 minutes)

      • Addition of uncoupler (FCCP or nigericin) to collapse proton gradient as control

  • ATP synthesis measurements:

    • Creation of artificial proton gradient:

      • Acid-base transition method: Preparation of liposomes at pH 5.5, dilution into pH 8.0 buffer

      • K⁺/valinomycin method: Creating membrane potential using K⁺ concentration gradient

    • ATP detection systems:

      • Luciferase-based luminescence assays for real-time monitoring

      • HPLC analysis for precise quantification

      • Coupled enzyme assays (hexokinase/glucose-6-phosphate dehydrogenase) with spectrophotometric detection

  • ATP hydrolysis measurements:

    • Phosphate release assays:

      • Malachite green colorimetric method

      • Radioactive [γ-³²P]ATP hydrolysis monitoring

    • Coupled enzyme systems:

      • Pyruvate kinase/lactate dehydrogenase linking ATP hydrolysis to NADH oxidation

      • Continuous spectrophotometric monitoring at 340 nm

These methodological approaches provide complementary information about ATP synthase function and can be used to assess the impact of mutations, inhibitors, or environmental conditions on enzyme activity. When applying these methods to P. fluorescens ATP synthase, researchers can gain insights into the remarkable bioenergetic adaptability this organism displays under stress conditions .

How can researchers effectively reconstitute this protein into liposomes for functional studies?

Effective reconstitution of recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB) into liposomes for functional studies requires careful optimization of multiple parameters. The following detailed protocol outlines the most successful methodological approach:

  • Liposome preparation:

    • Lipid composition optimization:

      • E. coli polar lipids or synthetic mixtures (POPE:POPG 3:1) provide bacterial membrane-like environments

      • Addition of 10-20% POPC can improve membrane stability

      • Preparation of lipids at 10-20 mg/ml in chloroform

    • Thin film formation:

      • Evaporation of chloroform under nitrogen stream

      • Complete removal of solvent under vacuum for 3-4 hours

    • Hydration:

      • Rehydration in buffer (typically 20 mM HEPES, 100 mM KCl, pH 7.4)

      • Vigorous vortexing with glass beads to form multilamellar vesicles

  • Proteoliposome formation:

    • Detergent-mediated reconstitution:

      • Solubilization of liposomes with mild detergent (0.5-1% Triton X-100 or octyl glucoside)

      • Addition of purified recombinant protein at protein-to-lipid ratio of 1:50 to 1:100 (w/w)

      • Incubation at 4°C for 30-60 minutes with gentle agitation

    • Detergent removal:

      • Bio-Beads SM-2 addition (80-100 mg/ml) in stepwise manner

      • Incubation periods: 1 hour at room temperature, overnight at 4°C, and additional 2 hours with fresh Bio-Beads

      • Alternative: Dialysis against detergent-free buffer for 24-48 hours with buffer changes

  • Quality control assessment:

    • Dynamic light scattering for size distribution (typical diameter 100-200 nm)

    • Freeze-fracture electron microscopy to verify protein incorporation

    • Protein quantification to determine reconstitution efficiency

    • Functional assays (proton pumping, ATP synthesis) to confirm activity

  • Functional optimization considerations:

    • For ATP synthase subunit a studies, co-reconstitution with other F0 sector subunits is typically necessary

    • The intact F0F1 complex reconstitution yields most functional data

    • Orientation of the protein can be manipulated by freeze-thaw cycles (3-5 cycles in liquid nitrogen)

This reconstitution methodology provides a reliable system for studying the function of ATP synthase components in a membrane environment that mimics their native context, enabling investigations into the remarkable bioenergetic properties of P. fluorescens ATP synthase.

What structural analysis techniques provide the most insight into this membrane protein's conformation?

Structural analysis of Pseudomonas fluorescens ATP synthase subunit a (atpB) requires specialized techniques suitable for membrane proteins. The following methodological approaches provide the most comprehensive structural insights:

  • Cryo-electron microscopy (cryo-EM):

    • Currently the gold standard for ATP synthase structural studies

    • Sample preparation considerations:

      • Purified protein in detergent micelles or reconstituted into nanodiscs

      • Protein concentration of 1-3 mg/ml

      • Vitrification on holey carbon grids with thin continuous carbon support

    • Data collection parameters:

      • 300 kV microscopes (Titan Krios, Glacios)

      • Direct electron detectors with movie mode acquisition

      • Collection of 3,000-5,000 micrographs for sufficient particle numbers

    • Processing workflow:

      • Motion correction and CTF estimation

      • Particle picking and 2D/3D classification

      • 3D refinement targeting 3-4 Å resolution

      • Focused refinement on membrane domain containing atpB

  • Cross-linking mass spectrometry:

    • Particularly valuable for mapping interaction interfaces

    • Protocol optimization:

      • Chemical cross-linkers (DSS, BS3) for lysine-lysine connections

      • Photo-activated cross-linkers for unbiased residue interactions

      • Controlled reaction conditions to prevent over-cross-linking

    • Analysis approach:

      • Enzymatic digestion and LC-MS/MS analysis

      • Specialized software (xQuest, Kojak) for cross-link identification

      • Integration with molecular modeling

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Probes protein dynamics and solvent accessibility

    • Experimental design:

      • Controlled D2O exposure times (10 sec to 24 hours)

      • Quenching and pepsin digestion

      • LC-MS analysis of deuterium incorporation

    • Data interpretation:

      • Identification of protected vs. exposed regions

      • Mapping results onto structural models

      • Comparison with functional data

  • Site-directed spin labeling with EPR spectroscopy:

    • Provides information on local environment and distances

    • Methodological approach:

      • Introduction of cysteine residues at strategic positions

      • Labeling with MTSL or other spin labels

      • CW-EPR for mobility information

      • DEER/PELDOR for long-range distance measurements (20-80 Å)

These complementary structural techniques, when combined with functional assays, provide comprehensive insights into the structure-function relationship of ATP synthase subunit a and how it contributes to P. fluorescens' remarkable ability to maintain energy homeostasis under varying environmental conditions .

What are the most promising future research directions for Pseudomonas fluorescens ATP synthase subunit a (atpB)?

The study of Pseudomonas fluorescens ATP synthase subunit a (atpB) presents several promising research directions that could significantly advance our understanding of bacterial bioenergetics and stress adaptation. Based on current knowledge, the most valuable future research avenues include:

  • Structure-function relationship exploration:

    • High-resolution structural determination of P. fluorescens ATP synthase, focusing on the membrane domain containing subunit a

    • Mapping the proton translocation pathway through the protein

    • Comparative structural analysis with ATP synthases from other bacteria to identify unique features

  • Stress adaptation mechanisms:

    • Detailed investigation of how oxidative stress affects ATP synthase subunit a structure and function

    • Elucidation of potential post-translational modifications under stress conditions

    • Understanding the molecular interface between ATP synthase and the alternative phospho-transfer networks that maintain ATP homeostasis

  • Metabolic integration studies:

    • Systems biology approaches to map the regulatory networks connecting ATP synthase activity to phospho-transfer pathways

    • Metabolic flux analysis under different stress conditions

    • Quantitative assessment of ATP production via oxidative phosphorylation versus substrate-level phosphorylation

  • Applied research potential:

    • Exploration of P. fluorescens ATP synthase components as potential antimicrobial targets

    • Engineering of stress-resistant ATP synthase variants based on P. fluorescens adaptations

    • Development of biosensors for environmental monitoring based on ATP synthase activity

These research directions would build upon the current understanding of P. fluorescens' remarkable ability to maintain ATP homeostasis despite oxidative stress , potentially revealing novel bioenergetic mechanisms that could be applied in biotechnology, medicine, and environmental science.

How does understanding this protein contribute to broader knowledge of bacterial bioenergetics?

Understanding Pseudomonas fluorescens ATP synthase subunit a (atpB) makes significant contributions to our broader knowledge of bacterial bioenergetics in several key ways:

  • Metabolic flexibility insights:

    • P. fluorescens demonstrates remarkable ability to maintain ATP homeostasis despite oxidative stress that impedes the TCA cycle and oxidative phosphorylation

    • This challenges conventional understanding of bacterial energy metabolism

    • Reveals sophisticated integration between membrane-bound ATP synthase function and cytoplasmic phospho-transfer networks

  • Evolutionary adaptation perspectives:

    • The structure and function of ATP synthase subunit a reflect evolutionary adaptations to diverse environments

    • Comparison with homologous proteins from other species provides insights into conserved mechanisms versus specialized adaptations

    • Highlights how bacteria evolve bioenergetic systems to thrive in challenging ecological niches

  • Stress response mechanisms:

    • P. fluorescens' ability to maintain ATP levels during oxidative stress reveals sophisticated regulatory mechanisms

    • Demonstrates how bacteria can rapidly reconfigure their metabolism to maintain energy homeostasis

    • Provides a model for understanding bacterial persistence under adverse conditions

  • Fundamental principles of energy coupling:

    • Studies of atpB contribute to understanding how proton gradients are coupled to ATP synthesis

    • Reveals details of the proton translocation pathway across the membrane

    • Provides insights into the molecular mechanism of rotary catalysis in ATP synthases

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.